KEGG   Capra hircus (goat): 102168522Help
Entry
102168522         CDS       T02910                                 

Gene name
UGT2A1
Definition
(RefSeq) UDP-glucuronosyltransferase 2A1
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
chx  Capra hircus (goat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102168522 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    102168522 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102168522 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102168522 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    102168522 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102168522 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    102168522 (UGT2A1)
   00983 Drug metabolism - other enzymes
    102168522 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102168522 (UGT2A1)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102168522 (UGT2A1)
Glycosyltransferases [BR:chx01003]
 Others
  Hydrophobic molecule
   102168522 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 694 aa AA seqDB search
MLNKISLLLSLQISLLGTTFGGNVLIWPMEGSHWLNVKIIIDELIKKGHNVTVLVASGAL
FITPTTNPSLISEIYEVPFGKERIEGVIKDFVLTWMEHRPSPVTIWRFYQEMAKVIKDFH
MVAREICDGVLKNEKLMEKLKKSKFEVLVSDPVFPCGDIIALKLGLPFIYSLRFSPASTV
EKHCGKVPYPPSYVPAILSELTDQMSFTDRIRNFISYHLQDYMFNTLWKSWDAYYSKALD
GSHWLNIKIILEELNQRNHNVTVLASSATLFINSNSDSPVNFEVIPVSYKKSNIDSLIEH
MIMLWIDHRPTPLTLWTFYKELGKLLDTFFRINIQICDGVLNNPKLMARLWKSRFDVLLA
DPVTICGDLVALKLGIPFMYTLRFSPASTVERHCGKIPAPVSYVPAALSELTDQMTFGER
LKNTISYPLQDYIFQSYWGEWNSYYSKVLGRPTTLCETMGKAEIWLIRTYWDFEFPRPYL
PNFEFVGGLHCKPAKPLPKVLWRYKGKKPATLGANTRLYDWIPQNDLLGHPKAKAFITHG
GTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNINTMTSADLLNALRTVINE
PSYKENAMRLKMIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHNLTWYQYHSLDVIG
FLLACVATAVFLVTKCCLFSCRKFGKTGKKKKRE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaagatcagtctactgttgtctcttcagataagtctcctaggaaccactttt
ggtgggaatgttctgatttggccaatggaaggtagtcattggctaaatgttaagataatt
atagatgagctgattaaaaaagggcataatgtgactgtcctagttgcttctggtgcactt
ttcatcacaccgaccactaacccatctctgatatctgaaatatatgaggtgccctttggc
aaagaaagaatagaaggagtgatcaaggactttgttttgacctggatggaacacagacca
tctcctgtaaccatttggagattctaccaagagatggccaaagtcatcaaggacttccac
atggtggccagagaaatctgtgacggtgttctcaaaaacgaaaagctaatggaaaagctg
aagaaaagcaaatttgaggtcttggtatcagatccagtctttccctgtggtgatataata
gctttaaaattgggactaccatttatctactccttgaggttttctccagcctcaacagtg
gaaaaacactgcgggaaggtaccgtaccctccttcctatgttcctgctattttatcagaa
ctcaccgaccagatgtctttcactgacagaataagaaatttcatttcctaccatctacag
gactacatgtttaatactctgtggaaatcgtgggatgcctactatagtaaagctttggat
ggcagccattggttaaatattaaaataattttagaagagttgaatcaaagaaatcacaat
gtgactgtactggcttcatcagcaactctattcatcaactccaattctgactctcctgtg
aattttgaggtgatacctgtttcctacaagaagagcaatatagattccttaattgaacat
atgataatgttgtggatagatcacagaccgactcctctcacactctggactttctataaa
gaactagggaaactcctagatactttcttccgaattaatatacaaatctgtgatggagta
ttaaacaaccccaagttaatggcaagactttggaaaagtcgttttgatgtgttgcttgcc
gacccagtaacaatctgcggagatctggttgctctgaaattaggaattccatttatgtac
accctgaggttctccccagcttcaacagtggagagacattgcggaaaaattccagcacct
gtgtcctatgtacctgcagccctttccgagctcacggaccagatgacctttggtgaaagg
cttaaaaacaccatatcttatcccctgcaagattatatatttcaatcctactggggtgag
tggaattcatactacagcaaagtcctaggaagacccactacgctatgcgagaccatgggg
aaagcagagatttggctcatcaggacatactgggattttgaatttcctcgtccatactta
ccaaattttgagtttgtaggaggattgcattgtaaaccggccaaaccattacctaaggtt
ttatggagatacaaaggaaagaaacctgccacgttaggagccaatactcggctctatgat
tggataccacagaatgatcttcttggtcatcccaaagcaaaagcgtttatcactcatggt
ggaaccaatgggatctatgaagctatctatcatggggtgcctatggtgggagtcccaatg
tttgctgatcagcctgacaacattgctcacatgaaggccaaaggagcagctgtggaagtg
aatataaacacaatgacaagtgcagatttgctcaatgccttgagaacagtcattaacgag
ccttcttataaagagaatgctatgaggttaaaaatgattcaccatgatcagcctgtaaag
cccctggaccgagcagtcttctggattgaatttgtcatgcgccacaaaggagccaagcac
ctgaggccagctgcccacaacctcacctggtaccagtaccattctctggatgtgatcggt
ttcctgctagcctgtgtggcaacagctgtattcttggtcacaaaatgttgtctgttttct
tgtcgaaaatttggtaaaacaggaaagaagaaaaaaagagaatag

DBGET integrated database retrieval system