KEGG   Capra hircus (goat): 102168842Help
Entry
102168842         CDS       T02910                                 

Gene name
ART1
Definition
(RefSeq) ADP-ribosyltransferase 1
  KO
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102168842 (ART1)
Cellular antigens [BR:chx04090]
 Proteins
  102168842 (ART1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chx00537]
 Enzymes
  102168842 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
15
AA seq 326 aa AA seqDB search
MQSPAMMSLLLVSMGLMEALQAQSHPVIRRDLLSREMPLDMALASFDDQYAGCAAAMAAA
LPELNRTEFQANKVYADGWAQASSQWRERQAWGPEWGVSPTRVRAPLGFREEHGVALLAY
TANSPLHKEFNAAVREAGRSRAHYLQHFSFKTLHFLLTEALQLLSSGQRPPQCHQVFRGV
QGLRFRPAGPGATVRLGGFASASLQNAAAQHFGEDTFFGIWTCLGAPIKGYSFFPGEEEV
LIPPFETFQVINASRPAQGPSRIFLRAVGKRSTYNCEYIKDKQCKSQRCRLDNSAVGQSP
LSAVWSLLLLLWFLVGEVFPERLGLL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcagagccctgccatgatgtctctgctgcttgtgtccatgggcctcatggaagcactt
caggcccagagccaccccgtcatacgacgagacctcctctctcgagaaatgcccctagac
atggccctggcctcctttgatgaccagtatgctggctgtgccgcagccatggcggctgct
ctcccggaactcaaccgcacagagttccaggccaacaaagtgtacgctgatggctgggcg
caggcaagcagccagtggcgggagcgccaggcctgggggcccgagtggggggtcagccct
acccgtgtgcgcgcccccctgggcttccgagaagagcacggggtggccctcctggcttac
acggccaacagccccttgcacaaagaattcaacgcggctgtgcgtgaggcgggtcgctcc
cgggcccactacctccagcacttctccttcaagacactccacttcctgctgaccgaagcc
ctgcagctgctgagcagcggccagcgcccaccccagtgccaccaggtgttccgaggagtg
cagggcctgcgcttccggccggcggggcctggggccaccgtcaggctagggggctttgcc
tctgcgtccctgcagaatgctgcggcccagcactttggggaagacaccttctttggcatc
tggacctgccttggggccccaatcaagggctactccttcttccctggggaggaggaagtg
ctgatccctccctttgagaccttccaggtgatcaacgccagcaggccagcccagggcccc
tcccgcatcttcctccgggccgtgggcaagcgcagcacatacaactgcgagtacatcaaa
gacaagcagtgcaagtctcagcgctgccgtctggataactcagccgtgggtcagagccct
ctttctgcagtctggtcccttctactgctgctctggttccttgttggggaagtctttcca
gagcgtctgggcctcctctaa

DBGET integrated database retrieval system