KEGG   Capra hircus (goat): 102169116Help
Entry
102169116         CDS       T02910                                 

Definition
ecto-ADP-ribosyltransferase 5-like
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102169116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 316 aa AA seqDB search
MIQATLLISLSCLSLYTLGSGVRRYDPGQGVTIQYLSLAPDTFDDAYVGCSEAMEEKAVL
LLEKEMANHTRLRESWETAQKAWEQKRPGLILPPGFRNQHGIAIMVYTNSSNTLYRELNR
AVRTGGGSWESYMSHFPFKALHFYLTRALQLLRSGGGCSREPGQMVFRGVRRIHFEPKSV
GDSIRLGQFASSSLDETVARRFGNATFFSLRTCSGAPIQALSVFPEEREVLIPPYEVFVV
TNFSKDGNKSLVTLSSSDQMCSHFNCAYLGEKKRPSCESMPIGGQGDSLSRRAFSLLSWK
TLLLASWGFQLLGAGL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatacaggcaactctgctgataagcctcagctgcctcagcctctacacccttggcagt
ggtgtccgccgttatgaccctgggcagggtgttaccatccagtacttgagcctggctcca
gatacattcgatgatgcctatgtgggctgctcagaggcgatggaggagaaagcagtgctt
ctgttagagaaggagatggccaaccatactcggttgcgggagtcctgggagacagcccag
aaggcctgggagcaaaaacgtccagggcttattctgcctcctggcttcagaaaccagcac
ggaatcgccatcatggtctacaccaactcatccaacactttgtaccgggagctgaaccgg
gctgtgcggactggcggtggctcctgggagtcctacatgagccacttccctttcaaggcc
ctgcatttctacctgacccgggccctgcagctgctgcggagtggtgggggctgcagcagg
gaacctgggcagatggtgtttcgtggcgtgcgcaggattcactttgaacccaagagtgtg
ggggactctatccgcttgggccagtttgcctccagctcactggatgagacagtggcccgt
agatttggtaatgccactttcttctctctaaggacttgctctggagcccccatccaggcc
ctgtctgtctttcctgaggagcgtgaggtgctgatccccccatatgaagtcttcgtggtg
acgaatttctctaaggatggaaacaaaagcctggtgactctctccagcagtgatcagatg
tgcagccactttaactgcgcctatctgggtgagaagaagaggccgagctgtgagtctatg
ccaattggagggcagggagactcactctccaggagggccttctctctgctctcctggaag
accctgctcttggcctcttgggggttccagctcttaggagctgggctctga

DBGET integrated database retrieval system