KEGG   Capra hircus (goat): 102169302Help
Entry
102169302         CDS       T02910                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Pathway
Estrogen signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    102169302 (NCOA1)
   04919 Thyroid hormone signaling pathway
    102169302 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102169302 (NCOA1)
   05224 Breast cancer
    102169302 (NCOA1)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102169302 (NCOA1)
Chromosome [BR:chx03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102169302 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
11
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEAARRNSHTFNCRMLIHRPDEPGPENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNPGMSVPRVNPSVNPSISPAHGVARSSTLPPSNSNMVPTRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPPLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPVSMTSTACNNSNRSYSNIPVTP
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSNDSKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
TGTSTSASTNSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASASVS
VTGQVQGNSSVKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPAPMTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAPQLPGLCETERMDGAV
TNVAIKSEILPSALQSTTARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWANNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMAMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEAPLAN
RSSMVNRGMTGNMGGQFGTGITPQMQQNVFQYPGSGMVPQGEANFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPTSGYQSPDMKAWQQGAMGNNNVFSQAIQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatctgaccctgctaacccagactcacataagagaaaa
gggtcaccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttggaagagctagctgagttattgtctgccaacatcagtgacattgacagctta
agtgtaaaaccagacaaatgcaagatattgaagaagacagtcgatcagatacaactaatg
aagagaatggaacaagagaaatcaacaactgatgatgaagtacagaaatcagacatctca
tcgagcagtcaaggagtgatagaaaaggaatccctggggcctcttcttttagaggctttg
gatgggtttttctttgttgtgaactgtgaagggaggattgtatttgtgtcagaaaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatactg
catgtgggtgatcatgcagaatttgtgaagaatctgctaccaaaatcactagtgaatgga
gttccttggcctcaagaagcagcacgccgaaacagccatacctttaactgcaggatgcta
attcaccgtccagatgagcctggccccgagaaccaggaagcttgccagcggtatgaagtg
atgcagtgtttcactgtgtcacagccgaaatcaattcaggaggatggagaagatttccag
tcatgtttgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggctgggaagatttagtgagaaagtgcatttatgcttttttc
caacctcaaggcagagagccatcttatgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaatcctgga
atgtcagtgccccgggtaaacccttccgtcaatcccagtatctctccagctcacggtgtg
gcccgttcatctaccttgccgccatccaacagcaacatggtacccaccagagtaaaccgc
cagcagagctcagaccttcatagcagcagtcatagcaattctagcaacagccaagggagt
tttggatgctcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaatccccctttaaacctcaataattcccctatggaaggtacagga
atatcccttgcacagttcatgtctccaaggagacaagttagttctggattggcaacaagg
cccaggatgccaaacaattcatttcctcctaatattccgacattaagctcccctgttagc
atgacaagtactgcctgtaataatagtaaccgatcctattcaaacatcccagtaacacct
ttacagagtatgaatgaaggacccaataactctgttggcttctctgccagctctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gaatccaaagataacaaagagattgcatccattttaaatgaaatgattcagtctgacaac
agctctaatgacagcaaacctctggattctgggcttctacataacaatgacagactctca
gatggagacaataaatactctcaaaccagtcacaaactagtgcagcttttgacaacgact
gcagagcagcagttacggcatgctgatatagacacaagttgcaaagaggtactctcttgc
acaggcacttccacctctgcctctactaactcttcaagtggttcttgcccctcctctcat
agctcactgaccgagcggcacaaaatcctacaccgtctcttacaggagggtagcccctcg
gatatcacaactttgtcggtggagcctgataagaaggacagtgcatctgcttctgtgtca
gtgactggacaggtccagggaaattccagtgtaaaactggaactggatgcctccaagaaa
aaagaatcaaaagaccatcagctcctacgctaccttttagataaagatgagaaagattta
agatccactccgaacctgagcctggatgatgtaaaggtgaaggtggaaaagaaagagcag
atggatccttgtaacacaaacccagcccccatgaccaaacctgctcctgaggaaattaaa
ctggagtcacagagccagtttacagctgaccttgaccagtttgatcagttactacccacg
ctggagaaggcaccacaattgccaggcttatgtgagacagagaggatggatggtgcagtc
accaatgtggccatcaaatcagagatcctgccatctgcacttcagtccaccactgccagg
cccacttccaggctgaacagattacctgaactggaattagaagcaattgataaccagttt
ggacaaccaggaactggtgatcagattccatgggcaaataatacagtgacagctgtaaac
cagaataagccagaagaccagtgtattagttcacaattagatgaacttctctgtccacca
acaacagtcgaaggaagaaatgatgagaaggcccttcttgaacagctggtatccttcctc
agtggaaaagatgaaactgaactagctgaactagacagagctttgggaattgacaagctt
gttcagggaggtggattagatgtattatcggagagatttccaccacagcaagcaacacca
ccgttgatgatggaagaaagacccaacctttattcccagccttattcttctccttcgcct
actgccaatctctctagccctttccaaggcatggtcaggcaaaaaccttcactggggact
atgcctgttcaagtaacacctcctcgaggtgctttttcacctggcatggccatgcagccc
aggcagacactaaacagacctccagctgcacccaaccaacttagacttcaacttcagcaa
cgattgcaaggacaacagcagttgatacaccaaaatcggcaagctatcttgaaccaattt
gcagcaaatgctcctgttggcatcaatatgagatcaggcatgcagcagcaaattacacct
cagccacccctgaatgcccagatgttggcacagcgccagcgggagttatatagtcaacag
caccgacagaggcagctaatacagcagcaaagagccatgctcatgaggcaacaaagcttt
gggaacaacctccctccctcatctggactgccagttcaaatggggaacccccgtcttcct
cagggtgctccacagcaattcccctacccaccaaactatggtacaaatccaggaacccca
cctgcctctaccagccctttttcacaactggcagcaaatcccgaggcgcccttggccaac
cgtagcagcatggtgaacagaggcatgacaggaaacatgggtgggcagtttggcactgga
atcactcctcagatgcagcagaacgtcttccagtacccaggatcaggaatggttccccaa
ggtgaggccaactttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagcagactccgcccacttctggctaccagtcacca
gacatgaaggcctggcagcaaggagcaatgggaaacaacaatgtattcagtcaagctata
cagaaccagcccacgcctgcacagccaggagtgtacaacaatatgagcatcaccgtgtcc
atggcaggtggaaatacaaatgttcagaacatgaacccaatgatgggccagatgcagatg
agctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
gcagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaaccc
acggcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system