KEGG   Capra hircus (goat): 102169350Help
Entry
102169350         CDS       T02910                                 

Gene name
AMY2B
Definition
amylase, alpha 2B (pancreatic)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
chx  Capra hircus (goat)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:chx00500]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:chx04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 511 aa AA seqDB search
MKFFLLLSAIGFCWAQYDPHTKSGRTSIVHLFEWRWVDVALECERYLAPKGFGGVQVSPP
NENAVITDPSRPWWERYQPVSYKLCTRSGNENEFKDMVTRCNNVGVRIYVDAVINHMTGS
GVSAGTRSTCGSYFNPGSEDFPAVPYSGWDFNDGKCKTGSGDIESYNDAYQVRDCRLVSL
LDLALEKDYVRSTIANYLNHLIDIGVAGFRIDASKHMWPGDIKAVLDKLNNLNTKWFPSG
SKPFIYQEVIDLGGEAITSSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDPRMYKMAVGFMLAHPYGFTRVMSSYRWT
RHFVDGTDVNDWMGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVMFRNVVDGQS
FTNWWDNGSNQVAFGRGNKGFIVFNNDDSTLSATLQTGLPAGTYCDVISGDKSGNSCTGI
QISVSSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttttctgttgctttcagcgattgggttctgctgggctcagtatgacccacac
accaaatctggacggacatccattgttcatctgtttgaatggcgctgggttgatgttgct
cttgaatgtgagcgatacttagcccccaaaggatttggaggggttcaggtctccccaccc
aatgaaaatgctgtgattactgacccttcaagaccttggtgggaaagataccaaccagtt
agctacaagttatgtacaagatcaggaaatgaaaatgaattcaaagacatggtgactaga
tgtaacaacgttggtgtccgcatttatgtggatgctgtaattaatcacatgactggaagt
ggtgtgagtgcgggaacaagaagtacttgtggaagttacttcaaccctggaagtgaggat
tttccagcagtcccatactctggatgggattttaatgatggaaaatgtaaaactggaagt
ggagatattgagagctataatgatgcttatcaggtcagggattgtcgtctcgttagtctt
cttgatcttgcactggagaaagattatgtgcgttctacgattgctaactacctaaatcat
ctcattgacattggtgtagcagggttccgaattgatgcttctaagcacatgtggcctgga
gacataaaggcagttttggataaactgaataatctaaacacaaagtggtttccttcagga
agtaaaccgttcatttaccaggaggtcattgatctgggtggtgaggcaattacaagcagt
gagtactttggaaatggccgtgtgacagaatttaaatatggtgcaaaactaggaacagtt
attcgcaagtggaatggagagaagatggcttacttaaagaactggggagaaggctggggt
ttcatgccttctgacagggcacttgtctttgttgataaccatgacaatcagcgagggcat
ggagctgggggagcatctattcttacattctgggatcctagaatgtacaaaatggcagtt
ggatttatgcttgctcatccctatggatttacacgagtaatgtcaagctaccgttggaca
agacattttgtggatggaacagatgttaatgattggatgggaccaccaaataataatgga
gtaattaaagaagttactattaatgcagatactacttgtggcaatgactgggtctgtgaa
catcgatggcgtcagataaggaacatggttatgttccgtaatgtagttgatggtcaatct
tttacaaactggtgggataatggcagcaaccaagtagcttttggaagaggaaacaaagga
ttcattgtctttaacaatgatgacagtacactatctgcaactttgcaaactggtcttcct
gctggtacatattgtgatgttatttctggagataaaagtggcaacagttgtacaggaatt
caaatcagtgtttccagtgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgattctaaattataa

DBGET integrated database retrieval system