KEGG   Capra hircus (goat): 102169371Help
Entry
102169371         CDS       T02910                                 

Gene name
MAOA
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
chx  Capra hircus (goat)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:chx00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:chx00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:chx00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:chx00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:chx00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:chx00380]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:chx00982]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:chx04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:chx04726]
Human Diseases; Substance dependence; Cocaine addiction [PATH:chx05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:chx05031]
Human Diseases; Substance dependence; Alcoholism [PATH:chx05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 527 aa AA seqDB search
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWEAPHAAEWDKMTMKDLIEKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSGQVSERIMQLLGDRVKL
RSPVTYVDQSSENITIETLSRELYECRYVISAIPPTLTSKIHFRPELPSERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKEHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKLAAKDIWIQEPEAED
VPAVEITPSFWERNLPSVPGLLKIVGFSTSMTALWFVMYRFRLLSRS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggagagtctgcagaagacgagtgacgcgggccagatgttcgacgtagtcgtgatagga
ggcggcatctcaggattatctgctgccaaactcttagccgaacatgaagttaatgttttg
gttttagaagcccgggagagagttggaggaagaacatacacagtgaggaatgaacatgtt
gactacgtagatgttggcggtgcttatgtaggcccgacccagaataggatcttacggtta
tctaagcaactgggtttagaaacttacaaagtgaatgtaaatgaacgtcttgttcattat
gtcaagggaaaaacttatccatttcggggtgccttccctccagtatggaatcccattgcc
tatctggattacaacaacctgtggcggaccatggataacatgggaaaagagattccagct
gatgcaccatgggaggccccacatgcagcagaatgggataagatgactatgaaagatctc
atcgaaaaaatctgctggacaaagactgctcggcagtttgcatctctctttgtgaatatc
aacgtgacctctgaaccccatgaggtgtctgccctgtggttcttgtggtacgtgaaacaa
tgtggaggcaccactcggatattctccattaccaacgggggccaggaacggaagtttgta
ggtggatccggtcaagtaagcgaacggataatgcaactcctaggggacagggtgaaactg
aggagtcctgtcacttacgttgaccagtcaagtgaaaacatcaccatagagaccctgagt
cgtgaactttatgagtgccgatatgtcattagcgccatcccaccaactttgacttccaag
atacactttagaccagagcttccatcagagcgaaaccagctgatacagcgtcttccaatg
ggggctgtcattaagtgcatgatgtattacaaggaggccttttggaagaaaaaggattac
tgtggctgtatgatcatcgaagatgaggaagctccaatttcaataacattggatgatacc
aagccagatggatcactgcctgctatcatgggcttcatcctcgctcgaaaagctgaccgc
cttgctaaagagcataaagatataagaaaaaggaaaatctgtgaactgtacgccaaagtg
ctaggatctcaagaagctttacatccggtgcactatgaagagaagaactggtgtcaggag
cagtactccggaggctgctacactgcctacttccccccagggatcatgactcaatatgga
agggtgattcgccaacctgtaggcaggatttactttgctggcacggagactgccacacag
tggagcggttacatggaaggagcagtagaggctggtgaacgagcagctagagaggttttg
aatgctttggggaagctggctgccaaagatatctggatccaagaacctgaagctgaagat
gttccagctgtagagatcacccccagcttctgggagagaaacctgccttccgtaccaggc
ctgctgaagatcgttgggttttccacatcgatgactgccctgtggtttgtgatgtacaga
ttcaggctgctaagccgatcctga

DBGET integrated database retrieval system