KEGG   Capra hircus (goat): 102169371Help
Entry
102169371         CDS       T02910                                 

Gene name
MAOA
Definition
(RefSeq) amine oxidase [flavin-containing] A
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
chx  Capra hircus (goat)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102169371 (MAOA)
   00330 Arginine and proline metabolism
    102169371 (MAOA)
   00340 Histidine metabolism
    102169371 (MAOA)
   00350 Tyrosine metabolism
    102169371 (MAOA)
   00360 Phenylalanine metabolism
    102169371 (MAOA)
   00380 Tryptophan metabolism
    102169371 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102169371 (MAOA)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102169371 (MAOA)
   04726 Serotonergic synapse
    102169371 (MAOA)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    102169371 (MAOA)
   05031 Amphetamine addiction
    102169371 (MAOA)
   05034 Alcoholism
    102169371 (MAOA)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102169371 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 546 aa AA seqDB search
MPPPITTPVPTPRESRNQSMESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLV
LEARERVGGRTYTVRNEHVDYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYV
KGKTYPFRGAFPPVWNPIAYLDYNNLWRTMDNMGKEIPADAPWEAPHAAEWDKMTMKDLI
EKICWTKTARQFASLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVG
GSGQVSERIMQLLGDRVKLRSPVTYVDQSSENITIETLSRELYECRYVISAIPPTLTSKI
HFRPELPSERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTK
PDGSLPAIMGFILARKADRLAKEHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQ
YSGGCYTAYFPPGIMTQYGRVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLN
ALGKLAAKDIWIQEPEAEDVPAVEITPSFWERNLPSVPGLLKIVGFSTSMTALWFVMYRF
RLLSRS
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctcctatcacgactcctgtacccacgccccgggagagccgcaaccagagcatg
gagagtctgcagaagacgagtgacgcgggccagatgttcgacgtagtcgtgataggaggc
ggcatctcaggattatctgctgccaaactcttagccgaacatgaagttaatgttttggtt
ttagaagcccgggagagagttggaggaagaacatacacagtgaggaatgaacatgttgac
tacgtagatgttggcggtgcttatgtaggcccgacccagaataggatcttacggttatct
aagcaactgggtttagaaacttacaaagtgaatgtaaatgaacgtcttgttcattatgtc
aagggaaaaacttatccatttcggggtgccttccctccagtatggaatcccattgcctat
ctggattacaacaacctgtggcggaccatggataacatgggaaaagagattccagctgat
gcaccatgggaggccccacatgcagcagaatgggataagatgactatgaaagatctcatc
gaaaaaatctgctggacaaagactgctcggcagtttgcatctctctttgtgaatatcaac
gtgacctctgaaccccatgaggtgtctgccctgtggttcttgtggtacgtgaaacaatgt
ggaggcaccactcggatattctccattaccaacgggggccaggaacggaagtttgtaggt
ggatccggtcaagtaagcgaacggataatgcaactcctaggggacagggtgaaactgagg
agtcctgtcacttacgttgaccagtcaagtgaaaacatcaccatagagaccctgagtcgt
gaactttatgagtgccgatatgtcattagcgccatcccaccaactttgacttccaagata
cactttagaccagagcttccatcagagcgaaaccagctgatacagcgtcttccaatgggg
gctgtcattaagtgcatgatgtattacaaggaggccttttggaagaaaaaggattactgt
ggctgtatgatcatcgaagatgaggaagctccaatttcaataacattggatgataccaag
ccagatggatcactgcctgctatcatgggcttcatcctcgctcgaaaagctgaccgcctt
gctaaagagcataaagatataagaaaaaggaaaatctgtgaactgtacgccaaagtgcta
ggatctcaagaagctttacatccggtgcactatgaagagaagaactggtgtcaggagcag
tactccggaggctgctacactgcctacttccccccagggatcatgactcaatatggaagg
gtgattcgccaacctgtaggcaggatttactttgctggcacggagactgccacacagtgg
agcggttacatggaaggagcagtagaggctggtgaacgagcagctagagaggttttgaat
gctttggggaagctggctgccaaagatatctggatccaagaacctgaagctgaagatgtt
ccagctgtagagatcacccccagcttctgggagagaaacctgccttccgtaccaggcctg
ctgaagatcgttgggttttccacatcgatgactgccctgtggtttgtgatgtacagattc
aggctgctaagccgatcctga

DBGET integrated database retrieval system