KEGG   Capra hircus (goat): 102169594Help
Entry
102169594         CDS       T02910                                 

Gene name
POMT2
Definition
protein-O-mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
chx  Capra hircus (goat)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102169594 (POMT2)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     102169594 (POMT2)
Glycosyltransferases [BR:chx01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   102169594 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 660 aa AA seqDB search
MGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFLFQKPGDNYEHHSYMGMRGFCAFL
GSMLIPLAYLTVLELSRSLPAALLTAALLTFDTGCLTLSQYILLDPILMFFIMAAMLSMV
KYNSCANRPFSAPWWFWLSLTGVNLAGALGVKFVGLFIILQVGWNTLSDLWHLFGDLSLS
MVTLGKHLTARILCLIVLPLALYIATYAVHFMVLNKSGPGDGFFSSAFQARLSGNNLHNA
SIPEHLAYGSVITVKNLRMAIGYLHSHRHFYPEGVGARQQQVTTYLHKDYNNLWIIKKHN
SNSADPLDPSHPVEFVRHGDIIRLEHKETSRNLHSHYHEAPLTRKHYQVTGYGINGSGDS
NDFWRIEVINRKFGNRIKVLRSRIRLIHLVTGCVLGSSGKVLPKWGWEQLEVTCTPYLKE
TLSSIWNVEDHINPKLPNISLEVLQPSFPEIMLESHLVMIRGNNGLKPKDNEFTSKPWHW
PINFQGLRFSGVNDTDFRVYLLGNPVIWWLNLLSIALYILSASIFAVAVQRGVHLPVKVE
GLSQVLLRGGGQLLFGWMMHYFPFFLMGRVLYFHHYFPAMLFSSMLTGLLWDTLLRLCAW
SLASYPLARCVHVLGILTLLLGTAYSFYLFHPLAYGMVGPLAQDPRSPMAGLRWLESWDF
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgggaagttactatatcaaccgcaccttcttctttgatgtgcacccacctctgggaaag
atgctgattggtctggccggctacctgagcgggtacgatggcacctttctgttccagaag
cctggggacaactatgagcatcacagctacatgggaatgagaggattctgtgcattcctt
ggctccatgctcatccccttggcctacctcactgtgctggagctgtcccggtctctccca
gcagcgctgctcacggccgccctcctcacctttgacacaggatgcctcactctgtcccag
tacatcctccttgaccccatcttgatgttcttcatcatggctgccatgctgagcatggtc
aagtacaactcctgtgccaacaggcccttctctgccccctggtggttctggctcagcctg
accggcgttaatctggctggcgctctgggagtcaagtttgttggcctcttcatcatcctg
caagtggggtggaacaccctttcagacctttggcacctgttcggagacctcagtctttca
atggtgaccttgggaaaacacctgaccgctcgcatcctgtgcctcatagtgctgccactg
gctctctatatcgccacctacgctgtccacttcatggtgctgaacaaaagcggtcccggt
gatggattcttcagttctgccttccaggcccggctttcaggaaacaaccttcacaacgcg
tccatccccgaacacctggcctacggctccgtgatcactgtgaagaacctgcggatggcc
atcggctacctccactcgcacaggcacttctaccccgagggcgtgggcgcccgccagcag
caggtcaccacctatttgcacaaggactacaacaacctgtggattatcaagaagcataat
tcgaactcagcagatcccctagacccttcacacccagtggagtttgtgagacatggagac
atcattcgactagaacacaaagagacttctcggaacttgcacagtcactatcacgaggcc
cccttgacccggaagcactatcaggtcactggctatggcataaatgggtcaggggactcg
aatgacttctggcggattgaggttataaacagaaaatttggaaaccgaatcaaagtgctg
agaagtcgaattcgcctcatccatttggtcacaggttgtgtcctgggctcctcgggaaag
gtcctgcccaagtggggctgggagcagttggaagtcacatgcacaccatacctaaaggaa
accctcagctccatctggaacgtggaggaccatatcaatcccaaattgccaaacatcagc
ctggaggtgctgcagcccagtttccctgagataatgctggagtcccacttggtgatgatc
cgggggaacaatggtctcaaacccaaggacaacgagttcacgtccaaaccctggcactgg
cctatcaactttcagggcctgcgcttctcaggggtcaatgacactgacttccgagtgtat
ctgctgggtaacccggtgatctggtggctgaacctgctgagcatcgccctctacatcctc
tcagcgagcatctttgctgtggctgtgcagaggggcgtgcatctgcctgtcaaggttgaa
gggctgtctcaggtcctgctgcgaggaggcgggcagctcctgttcggctggatgatgcat
tacttccccttcttcctgatgggccgggtcctctacttccaccactacttccccgccatg
ctcttctccagcatgctcacaggccttctgtgggataccctcctgcggctctgtgcctgg
agcctggcctcctatccactggccagatgcgtgcacgtgctgggcatcctgaccctgctc
ctgggaactgcctacagcttctacctcttccaccctctggcttacgggatggtaggtccc
ctggcccaggacccccgaagtccgatggccgggctcaggtggctggaatcgtgggacttt
tga

DBGET integrated database retrieval system