KEGG   Capra hircus (goat): 102171848Help
Entry
102171848         CDS       T02910                                 

Gene name
DHCR7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
chx  Capra hircus (goat)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    102171848 (DHCR7)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     102171848 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
29
AA seq 444 aa AA seqDB search
MAAKSQPSAPKTKSANGLTNGKAAAQGQWGRACDIWARTPPVTTKAAQIYAAWVTLQVLL
YMLLPDFCHKFLPGYVGGVQEGAVTPAGAVNKYEINGLQAWLLTHLLWFANAHLLSWFSP
TIIFDNWIPLLWCANILGYTVSTFAMVKGYLFPTDARECKFTGNFFYNYMMGVEFNPRIG
KWFDFKLFFNGRPGIVAWTLINLSFAAKQQELYGHVTNSMVLVNVLQAIYVLDFFWNETW
YLKTIDICHDHFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLPTSSTSADGQKHHSKLLV
SGFWGVARHFNYTGDLMGSLAYCLACGGGHLLPYFYIIFMAILLTHRCLRDEHRCANKHG
RDWERYTAAVHFRQQWVSDITWDILQPPGQPCPQLLLNTVAVGPPAPRAVAAPPAAPGAA
YVACLAVRLCSDDPETLATIKGVS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaagtcccagcccagcgcccccaaaaccaagagtgccaacggcctcaccaac
ggcaaggctgcagcccaggggcagtggggccgagcctgcgacatctgggccaggacgccg
cccgtgaccacaaaggcggcccagatctacgcagcgtgggtcacgctccaggtgctcctg
tacatgctgcttcctgacttctgccacaagtttctgccgggctacgtggggggtgttcag
gagggcgccgtgactcccgcaggagctgtcaacaagtacgagatcaacggcctgcaggcg
tggctcctcacgcacctcctgtggttcgccaacgcccacctcctctcctggttctccccc
accatcatcttcgacaactggatcccgctgctctggtgtgccaacatcctgggctacacc
gtttccacctttgccatggtcaagggctacctcttccccaccgacgcccgggaatgcaaa
ttcacaggcaatttcttttacaactacatgatgggcgttgagtttaacccccgaattggg
aagtggtttgacttcaagctcttcttcaatggacgccccgggatcgtcgcctggaccctc
atcaacctgtcctttgcagccaagcagcaggagctctacggccacgtgaccaactccatg
gtcctggtcaacgtcctgcaggccatctacgtgctggacttcttctggaatgaaacctgg
tacctgaaaaccattgacatctgccacgaccacttcgggtggtacctgggctggggggac
tgcgtctggctgccatacctgtacacgctgcagggcctgtacctggtgtaccaccccgtg
cagctgcccacctcctctacgtcggccgacgggcagaaacaccacagcaagctgctggtc
tcgggcttctggggtgtggcccgtcacttcaactacacgggcgaccttatgggcagcctg
gcgtactgcctggcctgtggcggcggccacctcctgccctatttctacattatcttcatg
gccatcctgctgacccaccgctgcctgcgggacgagcaccgctgtgccaacaagcacggc
cgcgactgggagcgctacacggctgccgtgcacttcagacaacagtgggtgtctgacatc
acatgggacatcctccagccccccggccagccctgccctcagctcttgctaaacacagta
gcagtgggcccgccagctccgcgggctgttgctgcaccgcctgcagctccaggtgctgcc
tacgtcgcctgcttggcggtgagactctgctcagatgacccagagaccttggccaccatc
aagggggtctcctag

DBGET integrated database retrieval system