KEGG   Capra hircus (goat): 102171870Help
Entry
102171870         CDS       T02910                                 

Gene name
CKMT2
Definition
(RefSeq) creatine kinase, mitochondrial 2 (sarcomeric)
  KO
K00933  
creatine kinase [EC:2.7.3.2]
Organism
chx  Capra hircus (goat)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102171870 (CKMT2)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102171870 (CKMT2)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102171870 (CKMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
7
AA seq 419 aa AA seqDB search
MASTFSKLLTGRNASLLFATLGTGALTTGYLLNKQNVCAAAREQHRLFPPSADYPDLRKH
NNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA
DLFDPVIKLRHNGYDPRVMKHPTDLDASKITQGQFDERYVLSSRVRTGRSIRGLSLPPAC
SRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAG
MARDWPDARGIWHNHDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQE
RGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVD
TAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGRK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccagtaccttctcaaagttgctgactggccgcaatgcctctctgttatttgctacc
ttgggcactggtgccctgaccacggggtacctgctgaataagcagaatgtgtgtgctgcg
gcccgggagcaacacagactattcccaccaagcgcagactaccctgacctgcgcaaacac
aacaactgcatggccgagtgcctcacgccggccatctatgccaagctccgcaacaaggtg
acgcccaacggctataccctggaccagtgtatccagaccggagtggacaaccctggccac
cccttcataaagaccgtgggcatggtggctggcgacgaggagtcctatgaggtgtttgcc
gacctttttgaccctgtcatcaagctgaggcacaatggctatgaccccagggtgatgaag
caccccacggatttggatgcatccaagatcacccaggggcagttcgacgagcgctacgtg
ctgtcgtctcgggtccgcacaggccgcagcatccgcgggctgagcctgccgccagcctgc
agccgggccgagcggagggaggtggagaacgtggccatcacggcactggagggcctcaag
ggggacctggccgggcgctactacaagctgtccgagatgacggagcaggaccagcagcgg
ctcatcgatgaccactttctatttgataagccagtatcccctttactaacttgtgctggg
atggcccgtgactggccagacgcccggggaatctggcataatcatgacaagacatttctc
atctggattaatgaggaagaccacaccagagtaatctctatggagaaaggaggcaatatg
aaaagagtatttgagcgattctgtcgtggacttaaagaggtggaacgcttaatccaagag
cgaggctgggagttcatgtggaatgagcgcctggggtacattttgacctgcccttcgaac
ctcggcacgggattgcgagctggtgtccacgtcaggatcccaaagctcagcaaggatcca
cggttttctaagattctggagaacctgagactccagaagcggggcaccggtggtgtggac
actgcagcggtagcagacgtgtatgacatttccaacatagatcgaattggccgatcggag
gtcgagcttgttcagatagtcatcgatggagtcaattacctggtggattgtgagaagaag
ctggagagaggccaggatattaaggtgccacctcctctacctcagtttggcaggaagtga

DBGET integrated database retrieval system