KEGG   Capra hircus (goat): 102173194Help
Entry
102173194         CDS       T02910                                 

Gene name
RNASE2
Definition
(RefSeq) ribonuclease A family member 2
  KO
K01168  pancreatic ribonuclease [EC:3.1.27.5]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     102173194 (RNASE2)
Messenger RNA biogenesis [BR:chx03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     102173194 (RNASE2)
Membrane trafficking [BR:chx04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102173194 (RNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA
Motif
Other DBs
NCBI-GeneID: 102173194
NCBI-ProteinID: XP_017909301
Position
10
AA seq 158 aa AA seqDB search
MVPIQQDSRLCLILLLGLLGMVISLHAPPGNLTWAQWFEIQHINMAHPQCNAAMRVVNRY
RMVCKDKNTFLHKTFAYVAGICNTPNVNCSKQGKMNCHNSSVQVPITYCNLTRNALNYTN
CSYQQTSAQKIFIIACENRSSRDSRRYPVVPVHLDKII
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggttccaatacagcaggattctcggctttgtctcattttgctgctggggctcttggga
atggtgatctcactccatgccccacctggtaatttaacctgggctcagtggtttgagatt
cagcacataaatatggcccaccctcaatgcaatgccgcaatgcgagtggttaaccgttac
agaatggtatgtaaagataaaaatacttttctccacaaaacatttgcttatgtagctggt
atttgtaacaccccaaatgtaaactgctctaaacaaggcaagatgaactgtcataatagc
tcagtccaagtgcctataacctactgcaacctcacaagaaatgcattgaactacaccaac
tgcagttaccagcagacatcggcacagaagatcttcatcatcgcctgtgagaacagatca
tcccgggacagtcgcaggtatcctgtggttccagttcacttggataagatcatctag

DBGET integrated database retrieval system