KEGG   Capra hircus (goat): 102173194Help
Entry
102173194         CDS       T02910                                 

Gene name
RNASE2
Definition
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Organism
chx  Capra hircus (goat)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 158 aa AA seqDB search
MVPIQQDSRLCLILLLGLLGMVISLHAPPGNLTWAQWFEIQHINMAHPQCNAAMRVVNRY
RMVCKDKNTFLHKTFAYVAGICNTPNVNCSKQGKMNCHNSSVQVPITYCNLARNALNYTN
RSYQQTSAQKIFIIACENRSSRDSRRYPVVPVHLDKII
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggttccaatacagcaggattctcggctttgtctcattttgctgctggggctcttggga
atggtgatctcactccatgccccacctggtaatttaacctgggctcagtggtttgagatt
cagcacataaatatggcccaccctcaatgcaatgccgcaatgcgagtggttaaccgttac
agaatggtatgtaaagataaaaatacttttctccacaaaacatttgcttatgtagctggt
atttgtaacaccccaaatgtaaactgctctaaacaaggcaagatgaactgtcataatagc
tcagtccaagtgcctataacctactgcaacctcgcaagaaatgcattgaactacaccaac
cgcagttaccagcagacatcggcacagaagatcttcatcatcgcctgtgagaacagatca
tcccgggacagtcgcaggtatcctgtggttccagttcacttggataagatcatctag

DBGET integrated database retrieval system