KEGG   Capra hircus (goat): 102173552Help
Entry
102173552         CDS       T02910                                 

Gene name
UGT2B4
Definition
UDP glucuronosyltransferase 2 family, polypeptide B4
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
chx  Capra hircus (goat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102173552 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    102173552 (UGT2B4)
   00500 Starch and sucrose metabolism
    102173552 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102173552 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102173552 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    102173552 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102173552 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    102173552 (UGT2B4)
   00983 Drug metabolism - other enzymes
    102173552 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102173552 (UGT2B4)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102173552 (UGT2B4)
Glycosyltransferases [BR:chx01003]
 Others
  Hydrophobic molecule
   102173552 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 535 aa AA seqDB search
MSKMSMKWLSLLLLLQLTCYFSSGSCGKVLVWPVEFSHWMNMKAVLDELVMRGHEVTVLI
SSASTITDANKPSAFKFEIFPVSLTKDDFENAVKNLIEKWTYMGKNSFWTNVSSLRELKS
LLWEFSGMLMKMCKEVVSKKKLITKLQESRFDVLLADAAGPCGELLTEILRIPLVYSLRF
SPGFLFEKYSGQLSFPPSYVPVIFSALSDDMTFMERVKNMIYVLYFDFWFQTFDEKTWNE
FYSEVLGRPTTFLETVGKADMWLIRTYWDFEFPRPVLPNFEFVGGLHCKPAKPLPKEMEE
FVQSSGENGIVVFTLGSMISNITEEKVNVIASALAQIPQKVLWRYDGKKPDTLGPNTRLY
KWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGLPLFADQPDNIARVKAKGAAVR
VDLETMSARDLLSALKEVINNPSYKEKAMWLSTIQHDQPIKPLDRAIFWIEFVMRHKGAK
HLRPAAHNLTWFQYHSLDVIGFLLACVATVVFVITKCFLFCYRKFAKTGKKQKRE
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatgtctatgaaatggctctcacttctgctgctgctacagctgacttgctac
tttagctctgggagttgtggaaaggtgctggtgtggccagtggaatttagtcattggatg
aatatgaaggcagttctggatgaactagtcatgaggggtcatgaggtgactgttctaata
tcttcagcttccactattactgatgccaacaaaccatctgcttttaagtttgagattttc
cctgtatctttaactaaagatgattttgagaatgctgtcaagaatttgattgagaaatgg
acatacatgggaaaaaattcattttggacaaatgtttcatcattgagagaattgaaaagc
ttactttgggaattttctggaatgcttatgaaaatgtgtaaagaagttgtttcaaaaaag
aagcttataacaaaactacaggaatcaaggtttgatgtccttcttgcagatgctgctgga
ccctgtggtgagctgctgactgagatacttagaatacctttagtatacagtctccgtttc
tcgcctggctttttgtttgaaaagtatagtggacaactttcatttccaccatcctatgta
cctgttatattttcagcattaagtgatgacatgacattcatggaaagggtcaaaaatatg
atatatgtactttattttgacttctggttccaaacatttgatgagaagacatggaacgag
ttttacagtgaagtactgggaagacccactacatttttagagacagttggaaaagctgat
atgtggctcattcgaacctactgggactttgaatttcctcgcccagtgttgccaaatttt
gaatttgttggaggcctccactgcaaacctgccaaacccctgcctaaggaaatggaagag
tttgttcagagctctggagaaaatggcattgtggtgtttactttggggtcaatgatcagt
aacataacagaagaaaaagtcaatgtaattgcatcagctcttgcccagattccacaaaaa
gttctatggagatatgatggcaagaaaccggataccttggggcccaatacccgtctgtat
aagtggatcccccaaaacgaccttcttggtcacccaaaaaccaaagcctttataactcat
ggtggaaccaatggcatttatgaggccatctatcatgggatccctatggtgggccttcct
ttgtttgctgatcaacctgataacattgcccgagtaaaagccaagggagcagctgtcaga
gtggacttggaaacaatgtcagcaagagatctgctcagtgcattgaaggaagtcattaac
aatccctcctacaaagagaaggctatgtggttatccaccattcaacacgatcagcctata
aagcccctggaccgagcaatcttctggattgagtttgtcatgcgccacaaaggagccaag
cacctgaggccagccgcccacaacctcacctggttccagtaccactctctggatgtgatt
gggttcctgctggcctgtgtggcaactgttgtatttgtcatcacaaaatgctttctcttt
tgttaccgcaagtttgctaaaacaggaaagaagcaaaagagagagtag

DBGET integrated database retrieval system