KEGG   Capra hircus (goat): 102173852Help
Entry
102173852         CDS       T02910                                 

Definition
brain ribonuclease-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     102173852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 168 aa AA seqDB search
MAPKSLVLLSLLVLVLLVWVQPSLGKESAAAKFRRQHMDSGSSSSGNSNYCNLMMKRRRM
THGRCKPVNTFVHESLDDVKAVCSQKNITCKNGQPNCYQSNSTMNITDCRETGSSKYPNC
AYKTSQKQKYITVACEGNPYVPVHFDGAVLLPATPLPSLPPPHKHRLL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaagtccctggtcctgttgtcactgctggtcctggtgctgctggtgtgggtc
cagccttccctgggcaaggaatctgcggccgccaagttccggaggcagcacatggactct
ggcagctcctccagcggcaactccaactactgcaacctgatgatgaagcgccggaggatg
acacatggacgatgcaagccagtgaacacctttgtgcacgagtccctggatgatgtcaag
gccgtgtgctcccagaaaaacatcacctgcaagaatgggcagcccaactgctaccagagc
aactccaccatgaacatcacagactgccgcgagacaggcagctctaagtaccccaattgt
gcctacaagactagccagaagcagaaatatatcactgtggcttgtgagggaaacccatat
gtaccagtccactttgatggtgcggtactcttacctgccacacccctaccctcactgcca
cctccacacaagcacaggcttctctga

DBGET integrated database retrieval system