KEGG   Capra hircus (goat): 102173898Help
Entry
102173898         CDS       T02910                                 

Gene name
PADI6
Definition
(RefSeq) peptidyl arginine deiminase 6
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     102173898 (PADI6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 686 aa AA seqDB search
MIRRASELHCEVSSKVVVPGGVVSPEGRAMAFRNIVPLSLDSPTHAVCVLGVELFLDISG
CAPPACESFSVDASLGVVVRVYRVESRGGPAAPRWPLSRPTDVLVSMTSPNFAEDEGKVL
VFYHQPKEDTPVATAVLHLTGVELSLDVDIYRSGRFEATDKQAKKTWVWGPGGRGAILLV
NCSPSVAGQPVDKNKVFSSEEVKSLSQMVLKVQGPSCITKNYRVVLHTSKEESEKARVYR
PQNDGSTAFELVLGPDQHTYTLAPQWDDRKGTLKETFYVEALEFPSASFSGLISFSVRAG
PRLAPQLVPETVLYKDTVLFRVAPCIFAPTTQMPLEVYLCRELQVQGFVSAVTELSERSN
SQVASVYEDPNRLGRWLQDEMAFCYTQAPHKTVSLVLDTPRVAKPDDFPMKYSLSPGVGY
LTLRTQDHTVASIDIIGKLMVSPPVKAQGKEYPLGRVLIGSSFYPSKDSRNMSQSLQDFL
RAQQVQAPVELFSDWLMTGHACEFMCFIPMQYKVEGKKDFRLLLASPSSCYKLLKERQKE
GYGDAMLFEGLRKDQLISNGREAVTINQLLADEKMRKQNDYAEKCIHLNRSILKRELGLQ
EEDIIPIPQLFCLEHIANAPPSEQTKRLYARPYFPDLGVSRLLEPLGFQCTFIDDFDCYL
TEIGDFCSCASIRRVPFAFKWWGMVP
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgatacgaagagcctccgagctacactgcgaagtaagcagcaaggttgtcgtgccgggt
ggggtggtcagcccagagggccgtgccatggccttccggaacatcgtccctctgtccctg
gacagcccaacccatgctgtgtgtgtgctgggcgtggagctcttcttagacatcagtggg
tgcgccccgccggcgtgtgagtccttctccgtggacgcgtctctgggcgtcgtggtccgc
gtctaccgggtggagagcaggggggggccggccgcgccccgctggcccctgtcgcgcccc
acggacgtgctggtgtcaatgacgtcccccaacttcgcggaggacgagggcaaggtcctg
gtcttctaccaccagcccaaggaggacacccccgtggccacggctgtgctccacctcacg
ggcgttgagctctccctggatgtggacatctaccgcagcgggcgctttgaggcgactgac
aaacaggctaagaaaacctgggtctggggccccggtggccggggtgccatcctgcttgtg
aactgcagcccttctgtcgcgggccagcccgtggacaagaacaaggtgttctcctctgaa
gaagtaaagagtttgtcccagatggtgctgaaagttcaggggcccagctgcattacaaag
aattaccgggtggtgctccacacctccaaggaagagtcggagaaggcaagagtctaccgg
ccacaaaatgatggttccacggccttcgagttggttctggggcctgaccagcacacctac
accttggcgccccagtgggatgacaggaagggtaccttgaaggaaaccttctatgttgaa
gccttagagtttccatccgccagcttctcgggcttgatttccttctcggtacgagcggga
cctcgtcttgctccgcagctggtcccagagactgtgctgtacaaagacacagtgctgttc
cgggtggccccctgcatctttgctcccaccacccagatgcctctggaggtgtacctgtgc
agagagctgcaggtccagggcttcgtgagcgcggtgacggagctgagcgagaggagcaac
agccaggtggcatccgtctacgaggaccccaaccgcctgggccggtggctccaggatgaa
atggcattctgctatacccaggctcctcacaagaccgtctccttggtcctggacacccct
cgggttgccaagcctgacgatttccccatgaaatactcactgagccctggggttggctac
ctgactctgcgcacccaggaccacacggtggccagcatagacatcattgggaaactgatg
gtgtccccccctgtgaaggcccaaggaaaagagtaccctctgggcagggtcctcatcggc
agcagcttttaccccagcaaggactcccggaacatgagtcagagcctccaggacttcctc
cgtgcccagcaagtccaggccccggtggaactcttctccgactggctgatgaccggccat
gcctgcgagttcatgtgcttcatccccatgcagtacaaggtggagggcaaaaaggacttc
cggctgctcctggccagccccagctcctgctacaagctgctcaaggagagacagaaggag
ggctatggagacgcgatgctctttgaagggcttaggaaggaccagctcatttctaacggg
agggaggccgttaccatcaaccaacttctggctgatgaaaagatgaggaagcagaatgac
tatgccgagaagtgcatccacctgaaccgcagcatcctcaagagggagttgggcctgcaa
gaggaggacatcatccccatcccgcagctcttctgcctggagcacatcgccaacgcgccc
cccagtgagcagaccaagaggctctacgcccggccctacttccccgacctgggggtctcc
cggctgctggagccgctgggcttccagtgcaccttcatcgacgacttcgactgctacctg
accgagatcggagacttctgttcctgcgccagcatccgccgggtgccctttgccttcaag
tggtggggcatggtcccctag

DBGET integrated database retrieval system