KEGG   Capra hircus (goat): 102173944Help
Entry
102173944         CDS       T02910                                 

Gene name
BMP8B
Definition
(RefSeq) bone morphogenetic protein 8b
  KO
K16622  
bone morphogenetic protein 8
Organism
chx  Capra hircus (goat)
Pathway
TGF-beta signaling pathway
Hippo signaling pathway
Module
BMP signaling
Brite
KEGG Orthology (KO) [BR:chx00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    102173944 (BMP8B)
   04390 Hippo signaling pathway
    102173944 (BMP8B)
Cytokines [BR:chx04052]
 TGF-beta family
  BMP5 subfamily
   102173944 (BMP8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 405 aa AA seqDB search
MAARPGPLWLLGLALCALSGGGVPGPRPPLGCPQRRLGPRERRDLQREILAVLGLPGRPR
PRAPPAAALLPASAPLFMLDLYRAVAGDDDEDGGAPERRLGRADLVMSFVNMVERDPALG
HQEPHWKEFHFDLTQIPAGEAVTAAEFRIYKLPSTHPLNQTLHISMFEVVLEQSNRESDL
FFLDLQTLRSGDEGWLVLDVTAASDRWLLNRNKDLGLRLYVETDDGRSVDPGLAGLLGRQ
APRSKQPFVVTFFRASPGLGPARAPRAARPLKRRPPKRTNELPPPNRLPGIFDDVHGSHG
RQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLL
KPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVRACGCH
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgccccgggccgctctggctgctgggcctggcgctgtgcgcgctgagcggc
ggcggcgtccccggcccgcgccccccgctcggctgcccgcagcgccgcctgggcccgcgc
gagcgccgcgacctgcagcgcgagatcctggctgtgctcgggctgcccgggcggccccgg
ccccgcgcgccccccgccgccgccctgctgccggcgtccgcgccgctcttcatgctcgac
ctgtaccgcgccgtggccggcgacgacgacgaggacggcggggcccccgagcggcgcctg
ggccgcgcagacctggtcatgagcttcgtcaacatggtggagcgtgaccctgccctgggc
caccaggagccccactggaaggagttccactttgaccttacccagattccggccggggag
gccgtcacggccgcggagttccggatttacaagctgcccagcacccacccgctcaaccag
acgctccacatcagcatgtttgaggtggtcctggagcagtccaacagggagtctgacttg
ttctttttggatcttcagacgctccgatctggggacgagggctggctggtgttggacgtg
acagcagccagtgaccgctggctcttgaaccgtaacaaggacctgggactccgcctctat
gtggaaacagatgatgggcgcagcgtggatcctggcctggccggtctgctggggcgacag
gctccgcgctccaaacagcctttcgtggtcacctttttcagggcgagccctggcctgggc
cccgcccgagccccacgggcagcgaggcccctgaagaggaggccgccgaaaaggaccaac
gagctgccgcccccgaacagactgccggggatcttcgatgacgtccacggctcccacggc
cggcaggtgtgccgtcggcacgagctgtacgtgagctttcaggacctgggctggctggac
tgggtcatcgccccccaaggctactcagcctattactgtgaaggggagtgctccttcccg
ctggactcctgcatgaacgccaccaaccacgccatcctgcagtccctggtgcacctgctg
aagccggacgcggtccccaaggcgtgctgcgcgcccaccaagctgagcgccacctccgtg
ctctactacgacagcagcaacaacgtcatcctgcgcaagcaccgcaacatggtggtccgc
gcctgcggctgccactga

DBGET integrated database retrieval system