KEGG   Capra hircus (goat): 102174381Help
Entry
102174381         CDS       T02910                                 

Gene name
SIRT6
Definition
(RefSeq) sirtuin 6
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
chx  Capra hircus (goat)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102174381 (SIRT6)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102174381 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 359 aa AA seqDB search
MSVNYAAGLSPYADRGKCGLPEVFDPPEELEQKVWELAQLIWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFENAQPTKTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECVKCKTQYVRDTVVGSMGLKPTGRLCTVAKSRGLRACRGE
LRDTILDWEDSLPDRDLTLADEASRSADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPHVVERALPPLPRPPAPKLEPK
EEDSPQLDSPVPASPKQEPTAEPCTQHNGSGPTSPKREQLDSPAPHRPPKRVKTEVVPS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctttcgccgtatgcggacaggggcaagtgcggtctc
cccgaggtcttcgacccccccgaggagttggagcagaaggtgtgggagctggcacagctc
atctggcagtcctccagtgtggtgttccacacaggcgcaggcatcagcactgcctcaggc
atccccgacttcaggggcccccatggcgtctggacgatggaggagcggggcctggccccc
aagttcgacactacctttgagaatgcccagcccacaaagacccacatggcgctggtgcag
ctggagcgcgtgggcctcctgcgcttcctggtcagccagaacgtggacggactgcacgtg
cgctccggcttccccagagacaagctggcagagctccacggaaacatgtttgtagaagaa
tgtgtcaagtgtaagacgcagtatgtccgggacaccgtggtgggcagcatgggcctaaaa
cccacaggccggctctgcaccgtggccaagtccaggggactgcgggcctgcaggggggag
ctgagagacactatcctggattgggaggattccctgcctgaccgggacctcaccttggcc
gacgaggccagcaggagtgcagacctgtccatcacactgggcacctccctgcaaatccgg
cccagcgggaaccttcccctcgccaccaagcgccgtggaggtcgcctggttatcgtcaac
cttcagcccaccaagcacgaccgccacgcagacctgcgaatccacggttatgttgatgag
gtcatgacacggctcatgaaacacctgggcctggagatcccggcctgggacggcccccac
gtggtggagagggcactgccgcccctgccacgcccacctgcccccaagctggagcccaag
gaggaggactccccccagctcgacagcccagtgcctgccagccccaagcaggaacccaca
gctgagccctgcacccagcacaatggttccggacccaccagccccaaaagggaacagctg
gacagccctgcccctcacaggcctcccaaaagagtgaaaaccgaggtggttcctagctga

DBGET integrated database retrieval system