KEGG   Capra hircus (goat): 102174479Help
Entry
102174479         CDS       T02910                                 

Definition
(RefSeq) seminal ribonuclease-like
Organism
chx  Capra hircus (goat)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
10
AA seq 171 aa AA seqDB search
MDVTVTSDFSSPIFLEGSEVITALKSPVALPLLVLALLLLRVQPSLGKESAAAKFERQHM
HSGSSPSSNSNCCNLVMFCRKMTQXKCKPVNTFVHESLDDVKAVCSQKKVACKNGQINCY
QSNSAMRITDCRQTGSSKYPNCAYKITRAEKRIIVACEGKPYVSVHFDASV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcacagtcaccagtgattttagctccccaatattcctcgaggggagtgaggtc
atcacggctctgaagtctccagtcgcgttgccactgctggtcctggcgctgctgctgctg
cgggtccagccttccctgggcaaggaatctgcagccgccaagttcgagcggcagcacatg
cactctggcagctcccccagcagcaactccaactgctgcaacctggtgatgttctgccgg
aagatgactcagnggaaatgcaagccagtgaacacctttgtgcacgagtccctggatgat
gtcaaggccgtgtgctcccagaagaaagtcgcctgcaaaaatgggcagatcaactgctac
cagagcaactccgccatgcgcatcacagactgccgccagactggcagctccaagtacccc
aactgcgcctacaagatcacccgggcggagaaacgcatcatagtggcctgtgagggaaaa
ccgtatgtgtcagtccacttcgatgcttcagtgtag

DBGET integrated database retrieval system