KEGG   Capra hircus (goat): 102174664Help
Entry
102174664         CDS       T02910                                 

Gene name
RNASE1
Definition
(RefSeq) ribonuclease, RNase A family, 1 (pancreatic)
Organism
chx  Capra hircus (goat)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 146 aa AA seqDB search
MALKFLVLLSLLVLVEVQPSLGKESAAAKFERQHMDSSTSSASSSNYCNQMMKSRNLTQD
RCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYK
TTQAEKHIIVACEGNPYVPVHFDASV
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagttcctggtcctgttgtcactgttggtcctggtcgaggtccagccttcc
ctgggcaaggaatctgcagccgccaagtttgagcggcagcacatggattccagcacttcc
tctgccagcagctccaactattgcaaccagatgatgaagagccggaacctgacccaagat
cgatgcaagccagtgaacaccttcgtgcatgagtccctggccgatgtccaggccgtgtgc
tcccagaaaaatgttgcctgcaagaatgggcagaccaattgctaccagagctactccacc
atgagcatcacagactgccgtgagaccggcagctccaagtaccccaactgtgcctacaag
accacccaggcagagaaacacatcatagtggcttgtgaggggaacccatacgtaccagtc
cacttcgatgcttcagtgtag

DBGET integrated database retrieval system