KEGG   Capra hircus (goat): 102175106Help
Entry
102175106         CDS       T02910                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
chx  Capra hircus (goat)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    102175106 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102175106 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102175106 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102175106 (SCD5)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102175106 (SCD5)
Lipid biosynthesis proteins [BR:chx01004]
 Desaturase
  First
   102175106 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
6
AA seq 337 aa AA seqDB search
MPGPAVDAEKVPFRSAKEEIRAGVGVEGSEGGGGGGGGGRERPGARGHRQDIVWRNVFLM
SLLHLAAVYSLVLIPKAQALTLLWAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLA
AANSMAFQNDIFEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRK
LDVTDLLADPVVRFQRKYYKITVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLN
VTWLVNSVAHMYGNRPYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNP
TTWFIDFMCWLGLATDRKRATKQMIEARKARTGDGSA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccgtggacgcggagaaggtccccttccgcagcgccaaggaggagatc
cgtgcgggggtcggggtcgagggctcggagggcggcggcggcggcggcggcggcggccgg
gagaggcccggcgcgcgcgggcaccggcaggacatcgtctggaggaacgtgttcctgatg
agcctgctccacttggcggccgtgtactccctggtgctcatccccaaagcccaggcgctc
actctgctctgggcctacttctgcttcctcctgactgctctgggtgtgacagctggtgcc
catcgtttgtggagccacaggtcctacaaggccaagctgcccctgaggatatttctggct
gctgccaactccatggctttccagaacgacatcttcgagtggtcgagggaccaccgagtc
catcacaagtactcggagacggatgctgacccgcacaatgcccgccggggcttcttcttc
tcccacatcggctggctatttgtccgcaagcatcgggacgtcattgagaaggggaggaag
cttgacgtcaccgacttgctggctgaccccgtggtccggttccagagaaagtactacaag
atcaccgtggtgctcatgtgcttcgtagtccccacgctggtgccctggtacatctgggga
gagagcctgtggaactcctacttcctggcctccatcctccgctacaccatctcactcaac
gtcacctggctggtcaacagcgtcgcccacatgtatggaaaccggccctatgacaagcac
atcagtcctcggcagaacccgctcgtcaccctgggtgccattggtgaaggtttccataac
taccatcacacctttccctttgactactctgcgagtgaatttggcttaaatttcaaccca
accacctggttcattgacttcatgtgttggctggggctagccactgaccgcaaacgggca
accaagcagatgatcgaagcccggaaagcccggactggagacgggagcgcctga

DBGET integrated database retrieval system