KEGG   Capra hircus (goat): 102175221Help
Entry
102175221         CDS       T02910                                 

Gene name
GPT
Definition
glutamic-pyruvate transaminase (alanine aminotransferase)
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
chx  Capra hircus (goat)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    102175221 (GPT)
   01210 2-Oxocarboxylic acid metabolism
    102175221 (GPT)
   01230 Biosynthesis of amino acids
    102175221 (GPT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102175221 (GPT)
Enzymes [BR:chx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102175221 (GPT)
Amino acid related enzymes [BR:chx01007]
 Aminotransferase (transaminase)
  Class I
   102175221 (GPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 300 aa AA seqDB search
MGQIPITFPRQVLALCVHPDLLNSPDFPDDAKRRAERILQACGGHSLGAYSISAGVQMIR
EDVARYIERRDGGIPSDPNNIFLSTGASDAIVRLVELLVAHGADLNGKSLMDETPLDVCG
DEEGAAGAARARVTRPAVSPPPIQVYQDNVYAEGSQFHSFKKVLTEMGPPYAAPAQPRRQ
QERRGVLAERAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPRMELPPRAVQRAQELGLAPD
MFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPLLEKLSQFHAKFTREYS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatccctatcaccttcccgcgccaggtcctggccctctgcgtccaccccgat
ctcctgaacagccctgacttccccgacgacgccaagagaagggcggagcgcatcttgcag
gcgtgtgggggccacagcctgggggcctacagcatcagcgctggcgtccagatgatccgc
gaggacgtggcgcggtacatcgagcggcgcgatggaggcattccttccgaccccaataac
atcttcctgtccacgggggccagcgatgccattgtgcgcctggtggagctgcttgtggca
catggggctgacctgaacggcaagtccttgatggacgagacgcctctcgatgtgtgtggg
gatgaggagggggcggcgggcgcggcgcgcgccagggtgacacggcccgctgtctccccg
cctcccattcaggtgtaccaagacaacgtgtatgccgagggctcgcagttccactcgttc
aagaaggtgctcacggagatggggccgccgtacgcggcaccagcccagccccgtcggcag
caggagaggcggggggtgctggccgagcgggctgccaaggccaagctcaccgagcaggtc
ttcaacgaagctcccggcatccgctgcaacccggtgcagggcgctatgtattccttcccg
cgcatggagctgcccccacgtgcagtgcagcgcgctcaggagctgggcctggctcccgac
atgttcttctgcctgcgcctcctagaggagactggcatctgcgtggtgcctgggagtggc
ttcggacaacgggaaggcacctaccactttaggatgactattctgccccccatggagaag
ttgcggcccctgctggagaagctgagccagttccatgctaagttcacccgcgagtactcc
tga

DBGET integrated database retrieval system