KEGG   Capra hircus (goat): 102176244Help
Entry
102176244         CDS       T02910                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase
  KO
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
chx  Capra hircus (goat)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102176244 (DBH)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102176244 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
11
AA seq 610 aa AA seqDB search
MKVPSPSAREAASMYGTAVAVFLVIVVAALQGSAPAESPFPFHIPLDPEGTLELSWNVSY
AQETVYFQLLVRELKAGVLFGMSDRGELENADLVVLWTDRDGAYFGDAWSDQKGQVHLDS
QQDYQLLRAQRTPEGLCLLFKRPFGTCDPNDYLIEDGTVHLVYGLLEEPLQSLEAINTSG
LRTGLQRVQLLKPSIPQPALPADTRTMEIRAPDVLIPGQQTTYWCYITELPDGFPQHHIV
MYEPIVTEGNEALVHHMEVFQCAAEFESVPHFSGPCDSKMKPQRLNYCRHVLAAWALGAK
AFYYPEEAGLAFGGPGSSRFLRLEVHYHNPLVIKGRRDSSGIRLYYTATLRRFDAGIMEL
GLVYTPVMAVPPQETAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLARD
GRETEVVNRDSHYSPHFQEIRMLRKVVSVHPGDVLITSCTYNTEDRRLATVGGFGILEEM
CVNYVHYYPQTQLELCKSAVDPGFLQKYFHLVNRFNSEEVCTCPQASVPEQFASVPWNSF
NREVLKALYGFAPISMHCNKSSAVRFQGEWDRQPLPEIVSRLEEPTPHCPASRAQSPTGP
TVLSIGEGKG
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtccccagccccagcgcgcgcgaggcggcctccatgtacggcaccgcggtggct
gtcttcctggtcatcgttgtggctgcgctgcagggctcggcccccgctgagagccccttc
cccttccacatccccctggaccccgaggggaccctggagctgtcctggaacgtcagctac
gctcaggagaccgtctacttccagctcctggtgcgggagctcaaggccggcgtcctgttc
gggatgtcggaccgaggggagctggagaatgccgatctggtcgtgctctggactgacagg
gacggcgcctacttcggggatgcctggagtgaccagaaggggcaggtccacctggactcc
cagcaggactaccagcttctgcgggcacagaggacgccagaaggcctgtgtctcctcttc
aagaggccctttggcacctgtgaccccaacgactacctcatcgaggacggcaccgtccac
ctggtgtatggactcctggaggagccgctccagtccctggaggccatcaacacctccggc
ttgcgcacggggctgcagagggtgcagctgctgaagcccagcattccgcagccggccctg
cccgcggacacgcgcaccatggagatccgcgcccccgacgtgctcatccccggccagcag
accacgtactggtgctacatcaccgagctcccagatggcttcccccagcaccacatcgtc
atgtatgagcccatcgtcaccgagggcaacgaggcactggtacaccacatggaggtcttc
cagtgcgccgccgagttcgagagcgtcccccacttcagcgggccctgcgactccaagatg
aagccgcagcggctcaactactgccgccacgtgctggccgcctgggccctgggcgccaag
gccttttactacccagaggaagctggcctggccttcggggggcccggctcctccagattt
ctccgcctggaagttcactaccacaacccgctggtgattaaaggccggcgcgactcctcg
ggcatccgcctgtactacacggccacgctgcggcgcttcgatgcgggcatcatggagctg
ggcctggtgtacacgcccgtgatggccgtccccccacaggagacggccttcgtcctcacc
ggctactgcacagacaagtgcacccagctggccctgcccccctcggggatccacatcttc
gcctcgcagctccacacgcacctgacgggccggaaggtggtcacggtgctggccagggac
ggccgggagacagaggtcgtgaacagggacagccactacagcccgcacttccaggagatc
cgcatgttgaggaaggtcgtgtctgtccacccgggagacgtgctcatcacctcctgcacg
tacaacacggaagacaggaggctggccaccgtgggcggcttcgggatcctggaggagatg
tgtgtcaactacgtgcactactacccccagacgcagctggagctctgcaagagcgccgtg
gaccccggcttcctgcagaagtatttccaccttgtgaacaggttcaacagcgaggaagtc
tgcacctgcccccaggcgtctgtccccgagcagtttgcctctgtgccctggaactccttc
aaccgcgaggtactcaaggccctgtacggctttgcgcccatctccatgcactgcaacaag
tcctcggccgtccgcttccagggcgagtgggatcggcagcccctgcctgagatcgtatcc
aggctggaagagcccaccccgcactgcccggccagccgagctcagagccccactggcccc
actgtactcagcatcggggagggcaaaggttga

DBGET integrated database retrieval system