KEGG   Capra hircus (goat): 102176244Help
Entry
102176244         CDS       T02910                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
chx  Capra hircus (goat)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102176244 (DBH)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102176244 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 604 aa AA seqDB search
MKVPSPSAREAASMYGTAVAVFLVIVVAALQGSAPAESPFPFHIPLDPEGTLELSWNVSY
AQETVYFQLLVRELKAGVLFGMSDRGELENADLVVLWTDRDGAYFGDAWSDQKGQVHLDS
QQDYQLLRAQRTPEGLCLLFKRPFGTCDPNDYLIEDGTVHLVYGLLEEPLQSLEAINTSG
LRTGLQRVQLLKPSIPQPXXXXTGCSPPILQMGKQRPSREGSFSGGERVGVGSQRALAPQ
YEPIVTEGNEALVHHMEVFQCAAEFESVPHFSGPCDSKMKPQRLNYCRHVLAAWALGAKA
FYYPEEAGLAFGGPGSSRFLRLEVHYHNPLVIKADLGSRKVQRLLRRETQAGGEGCERSS
LSGPGGMAALEDEEPLHEGSRHVLRSRWRDRLCLDMEVGKASMFWKAQVVRPGGCIEVGA
REQDGWVALHPKEIRMLRKVVSVHPGDVLITSCTYNTEDRRLATVGGFGILEEMCVNYVH
YYPQTQLELCKSAVDPGFLQKYFHLVNRFNSEEVCTCPQASVPEQFASVPWNSFNREVLK
ALYGFAPISMHCNKSSAVRFQGEWDRQPLPEIVSRLEEPTPHCPASRAQSPTGPTVLSIG
EGKG
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtccccagccccagcgcgcgcgaggcggcctccatgtacggcaccgcggtggct
gtcttcctggtcatcgttgtggctgcgctgcagggctcggcccccgccgagagccccttc
cccttccacatccccctggaccccgaggggaccctggagctgtcctggaacgtcagctac
gctcaggagaccgtctacttccagctcctggtgcgggagctcaaggccggcgtcctgttc
gggatgtcggaccgaggggagctggagaatgccgatctggtcgtgctctggactgacagg
gacggcgcctacttcggggatgcctggagtgaccagaaggggcaggtccacctggactcc
cagcaggactaccagcttctgcgggcacagaggacgccagaaggcctgtgtctcctcttc
aagaggccctttggcacctgtgaccccaacgactacctcatcgaggacggcaccgtccac
ctggtgtatggactcctggaggagccgctccagtccctggaggccatcaacacctccggc
ttgcgcacggggctgcagagggtgcagctgctgaagcccagcattccgcagccnnnnnnn
nnnntcaccgggtgcagccctcccattttacagatgggcaagcagaggcccagtcgggag
gggagcttcagtgggggtgagcgtgtgggggtggggtctcagcgggcgctcgccccgcag
tatgagcccatcgtcaccgagggcaacgaggcactggtacaccacatggaggtcttccag
tgcgccgccgagttcgagagcgtcccccacttcagcgggccctgcgactccaagatgaag
ccgcagcggctcaactactgccgccacgtgctggccgcctgggccctgggcgccaaggcc
ttttactacccagaggaagctggcctggccttcggggggcccggctcctccagatttctc
cgcctggaagttcactaccacaacccgctggtgattaaagcagacctagggtccaggaag
gtgcaaaggcttctcaggagggagacacaagcagggggtgaggggtgtgaaaggagcagt
ctcagtggcccgggcggcatggcggccttggaggacgaggagcctcttcacgagggaagc
cgacacgtgctgcgctccagatggagggacaggctgtgcctagacatggaggtgggcaag
gccagcatgttctggaaagcacaggtggtccggcctggaggctgcatagaggtgggggcc
agagagcaggacggctgggtcgctctgcacccgaaggagatccgcatgttgaggaaggtc
gtgtctgtccacccgggagacgtgctcatcacctcctgcacgtacaacacggaagacagg
aggctggccaccgtgggcggcttcgggatcctggaggagatgtgtgtcaactacgtgcac
tactacccccagacgcagctggagctctgcaagagtgccgtggaccccggcttcctgcag
aagtatttccaccttgtgaacaggttcaacagcgaggaagtctgcacctgcccccaggcg
tctgtccccgagcagtttgcctctgtgccctggaactccttcaaccgcgaggtactcaag
gccctgtacggcttcgcgcccatctccatgcactgcaacaagtcctcggccgtccgcttc
cagggcgagtgggatcggcagcccctgcctgagatcgtatccaggctggaagagcccacc
ccgcactgcccggccagccgagctcagagccccactggccccactgtactcagcatcggg
gagggcaaaggttga

DBGET integrated database retrieval system