KEGG   Capra hircus (goat): 102176852Help
Entry
102176852         CDS       T02910                                 

Gene name
KAT6A
Definition
(RefSeq) lysine acetyltransferase 6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:chx00001]
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102176852 (KAT6A)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102176852 (KAT6A)
Chromosome [BR:chx03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102176852 (KAT6A)
   HAT complexes
    MOZ/MORF complex
     102176852 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
27
AA seq 2021 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGGAASGLHQQLRLAIKRAVGHGRLLKDGPLYRLNTKATNVDGKE
SSESLSSLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQTTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSEEGYLEQIDGLDFCRDGSVPLKFNKKTKGLIDGLTKFFTPSP
DGRKPRGEVVDYSEQYRARKKGSRKPSTSDWPTDNQDGWDGKQESEDRLFGSQEIMTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRAILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEEEEEEEEEEEEEEEEEEEEEEEREPEERQSQERELEPNVGKSASRENKEQDSY
TSVESEKKPEVTTPASTTRLSKQVLPRDSLPANSQPSRRGRWGRKNRKAQERFGDKDPKL
LLEETPAPQEQYGDCEEKSEPSQEQFVESEEPAAASQEQPSQDGKPDGPKRRPGEGLELW
RGPPKKSPEPLKCGLPDAHDRLPRRYSEGRYCEGRYADGDRPALRGCSESSEEDGEPESP
RSSSPPVLTKPTLKRKKPILHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERP
MPRLEPTFEIDEEEEEEDESELFSRGYFHRLASQDVLRCRSDSKRKSKDEDDDEESDDAD
DTPVLKPVSLLRKCDVKDAALEPDTSTPMKKKKGWPKGKSRKPVHWKKRAGRKPGFKLSR
EMVPLSAQECVVEPIVPLPKAGRKSKMEENEETVEPKDDLPLTEERKEEEELPLEAEEVE
EGEEEDTTSSDVRAASPADASSPEAEAKEPEAGEEEEKPRVPAEQRPSEEAPQELARREP
EEEEDTAAETNQSEDHDADDEDDGHLEPAKKEEEPGDPPAREGVKEEPGGREAFLDPNVQ
GSGENPKDKEEMEPDSEEEQTSHEASVVSEHMPGSEDDREEDSRSKEELLELKEEEEIPH
SELDLETVQAVQSLTQEERGEHEGAYQDCEETLAACQTLQSYTQADEDPPLALVEDCHAS
EHNSPLSSVQSHPSQSVRSVSSPSVPALEGGYTQISPEQGSLSAPSMQNMETSPMMDVPS
VSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNSSSQSSCSYGLSSSSSL
TQNSCVVTQQMAGMGGGCSLMPQSSVPPAANCGIKSPQSCAVERPPSTQQPPPPQPSQQP
PPQPQPPAPPPPPAQPPPPPPPPPQQPQPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPES
GSAGNISIYERIPGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATS
VSLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQ
RLQGQMPVKGHISIRSKSAPLPSAAAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNL
MPTPAYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGVMGGQAY
PQQPMQPSPHGNVMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6066 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgccaacccgctgtacacggagtggattttggaggccataaaaaaagtg
aagaagcaaaaacagcggccttcagaagaaaggatatgcaatgcagtgtcttcatcccat
ggcttggatcgtaaaactgttttagagcaactggagttgagtgtcaaggatggaacaatt
ttgaaggtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaacctcgaaaccatggaaaattggataataagcaaaatgtagactggaat
aaactgatcaagagggcagttgagggcttggcggagtccggcggctcaactctgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcattatttggaggcggtgctgcc
tctggccttcaccagcagttacgattggctattaaacgcgccgttggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccaatgtggatgggaaagag
agttctgagtctctttcctctttacctccagtgtcactccttccacatgaaaaggataag
ccggttgctgaacccatccccatctgtagcttctgtcttggcacaaaagagcaaaaccga
gaaaagaagccagaggaactcatctcctgtgcagactgcggcaacagtggtcatccatcc
tgtttgaagttttcccccgagctaacagtccgagtgaaggccttacggtggcagtgcatc
gagtgtaaaacgtgcagctcctgtcgcgatcaaggcaaaaatgcagataacatgctcttt
tgtgattcctgtgaccggggttttcacatggaatgttgtgatccgccactcactcggatg
ccaaaaggcatgtggatatgtcagatatgtcgacctaggaaaaaaggaaggaagcttctg
cagaagaaggcagcacagataaaacggcgctacgctaatccaataggacgtccaaaaaac
aggttaaagaagcaaaccacggtgtcaaaaggtcccttcagcaaagttcgaacaggccct
ggaaggggtcggaaacgtaaaatcactctctccagccagtcagcatcatcatcagaagaa
ggatacctagagcaaatagatggcttggacttctgcagagatggcagtgtccccttgaag
ttcaataagaaaaccaaagggctcatcgatggccttaccaaattctttaccccttctccc
gatgggcggaagcctcggggggaagtggtagactactctgagcaatacagagctcggaag
aagggcagcaggaagccaagcacttcagattggcccacagacaatcaggacggctgggat
ggcaaacaagaaagcgaggaccggctctttgggagtcaggaaatcatgactgagaaggat
atggaattatttcgtgacatccaagaacaagcgctgcagaaagttggagtgactggtcct
cctgacccacaagtccgctgtccttctgttatcgagtttgggaagtatgagattcatacc
tggtactcctctccatatcctcaagaatactcaaggctgcctaagttatatctctgtgaa
ttctgtctaaaatatatgaaaagtagagctatcctgcagcagcacatgaagaagtgtggt
tggttccatcctcctgctaatgagatttatagaaagaataacatttctgtttttgaggtt
gatgggaatgtgagtaccatttattgtcagaacctgtgtctcttggcaaagttgtttctt
gaccacaaaacactctattatgacgtggagccatttcttttttatgttctaacccagaat
gatgtcaagggctgccaccttgtcggctacttttctaaagaaaagcactgtcaacagaaa
tataacgtttcctgtataatgattcttccccagtaccaacgcaagggctatgggaggttt
ctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagagaaa
ccgctgtctgatctaggtcgcctttcctacatggcttattggaaaagtgtaatactggag
tgcctttatcaccagaatgacaagcaaatcagcatcaagaagttgagtaagttgactgga
atctgccctcaagacattacttccacactccaccacctgcgaatgctggacttccggagt
gaccaatttgtgattatccgccgggaaaagcttatccaggatcacatggcaaagcttcag
ctgaatctgcggcctgtagatgtagatcccgagtgtttgcgctggactcccgtcatagtc
tccaattctgttgtctcggaggaggaggaggaggaggaggaggaggaggaggaggaagaa
gaggaggaggaggaagaggaggaggagagagagccggaagagcgtcagagccaggaacga
gaattggagccaaatgtggggaagtctgcatctcgtgagaacaaagaacaggattcttac
acttcagtagaaagtgagaagaaaccagaagttaccacaccagccagtaccactcgtttg
agcaaacaggtccttccccgtgacagtcttcctgccaatagtcagccgtctcggcgaggc
cgctgggggaggaagaacagaaaagcccaggaacgctttggtgataaggacccgaaactg
ctcttggaagagacgccagccccccaggagcagtacggagactgtgaggaaaagtcagaa
ccttcccaggagcagttcgtggagagcgaggagccagcggcagcctcccaggagcagccg
agccaggacgggaagccggatgggcccaagaggagacctggcgaggggctcgagctctgg
cgaggcccgccgaagaagagccccgagcccctgaagtgcgggctgcccgacgcccacgac
cggctgccccgtcgctacagcgaggggcgctactgcgaaggccgctacgctgacggggac
cgccccgcgctgcggggctgcagcgagagcagcgaggaggacggggagcccgagagtccc
cggtccagctcgcccccggtgctcaccaagcccacgctgaagcggaagaaaccaattctt
caccgaagaaggagagtccgaaagcgcaaacaccacaatagcagtgtggtcacagagacc
atttctgagaccacggaggtcttagacgagccttttgaagactctgactccgagaggccg
atgccgagattagagccgacgttcgagattgatgaggaggaggaagaagaggatgagagc
gaactcttctctcgagggtactttcatcgcttggcctcccaggacgttctcaggtgtcgg
tccgattctaagaggaagtctaaagatgaagacgatgacgaagagtcagatgatgctgat
gacactcctgtcctaaagccagtgtctctcttgagaaaatgtgatgtgaaggacgctgca
cttgagccagatacatccacgcccatgaagaagaagaagggatggcccaagggcaagagc
cgcaaaccagtccactggaagaagagagctggtcgcaagccgggctttaagctgagtcgg
gagatggtacccctgtctgctcaagagtgcgtcgttgagcccatcgtcccccttccgaaa
gcaggacgtaaatccaaaatggaagagaacgaagaaactgttgaaccaaaagacgacttg
cctttaacggaggaaaggaaggaagaggaggagctgcccctggaagcggaggaggttgag
gagggggaggaggaggacaccaccagcagtgacgtcagggcggcctctcccgccgacgcc
agcagccccgaggccgaagccaaggagcccgaggccggtgaggaggaggaaaagccccgc
gtccccgcagagcagcggccgtcggaggaggcgccgcaggagctggccaggcgggagccc
gaggaggaggaggacacggctgcggagaccaaccagagcgaagaccacgacgcggatgat
gaggacgacggccacctggagcccgccaagaaggaggaggagccgggggacccgccggcg
cgggagggcgtcaaggaggagccaggcggccgggaggcttttttagatcctaacgtgcag
ggcagcggggagaacccgaaagacaaggaggagatggagccggattctgaggaggagcag
acttcacacgaggcatccgtggtgtccgagcacatgccgggctctgaggatgaccgcgag
gaggactcacgctcgaaggaggagctactggagctgaaggaggaggaggagatcccacac
agtgagctggacctggagacggtgcaggccgtgcagtccctgacgcaggaggagcgcggc
gagcacgagggcgcctaccaggactgcgaggagacgctggccgcctgccagacactgcag
agctacacgcaggccgacgaggaccctccgctggccctggtggaggactgccatgcctcg
gagcacaacagcccgctgtcctccgtccagtcccaccccagccagtcagtgcgctcggtc
agcagccccagcgtgcccgccctcgaagggggctacacccagatcagcccggagcaagga
tccctgtccgccccgtctatgcagaacatggagaccagccccatgatggacgtgccttcc
gtatccgaccactcccagcaggtggtggacagcggcttcagtgacctgggcagcatcgag
agcaccacggagaactacgagaaccccagcagctacgactccaccatgggcggcagcatc
tgtgggaacagctcatcccagagcagctgctcctacggcctgtcgtcctccagcagcctc
acccagaacagctgtgtggtcacccagcagatggctggcatgggcggcggctgcagcctg
atgccgcagagcagcgtgccgcccgccgccaactgcggcatcaagtccccgcagagctgt
gcggtcgagaggcctcccagcacgcagcagccgccgccaccccagccgtcacagcagccc
ccgccacagcctcagccaccggccccgcccccaccgccggcccagccgccgcccccgccc
ccgcccccgccccagcagccacagcccccacccccgccccagcagcagcccccgctgtca
cagtgcagcatgaacaacagcttcactccggcgcccatgatcatggagatccccgagtcc
ggcagcgcggggaacatcagcatctacgagcggatccccggggacttcggtgccggcagc
tactcccagccgtcggccaccttcagtctagccaagttgcagcagctgaccaacaccatt
atggacccccatgccatgccttatagccattctcctgctgtgacttcctatgcaaccagt
gtttctctgtccaacacgggactggctcagctggctccatcgcatcccttagcggggacc
cctcaagcacaagccaccatgacgccgcccccgaacttggcctccaccaccatgaacctc
acgtcccctctgctgcagtgcaacatgtctgccaccaacattggcattccccacactcag
cggctgcaagggcagatgcccgtcaaggggcacatctccatccgctccaagtcggcgccc
ctgccctccgcggcggctcaccagcagcagctgtacggccgcagcccgcccgcggtcgcc
atgcaggccggcccgcgtgccttggccgtgcagcgtggcatgaacatgggggtgaacttg
atgcccacccctgcctataatgtcaattccatgaatatgaacaccctgaacgccatgaac
agctatcgaatgacccagcccatgatgaacagcagttaccatagtaacccggcctacatg
aaccagacagcacagtatcctatgcagatgcagatgggggtgatggggggccaggcctac
ccccagcagcctatgcagccgagcccgcacggaaacgtgatgtacacgggcccctcccat
cacagctacatgaacgcggcgggcgtgcccaagcagtcgctcaacggaccttacatgaga
agatga

DBGET integrated database retrieval system