KEGG   Capra hircus (goat): 102177982Help
Entry
102177982         CDS       T02910                                 

Gene name
TGM1
Definition
transglutaminase 1
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
chx  Capra hircus (goat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 790 aa AA seqDB search
MSSPTPSSGGPRSDVGRWGGNPWQPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCSRGSD
SRRPGSRGSAVNAAGDGTIREGMLVVTGMDLLSSRSDQNRREHHTDEFEYDELILRRGQP
FHMVLFLSRPYESSDHVTLELCIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKSSGQNLN
LRVHTSPNAIIGKFQFTVRTRCKAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQE
YVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRRDPVSVSRVIS
AMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGNSVPFGQCWVFAGVTTT
VLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRP
DLPSGFDGWQVVDATPQETSSGIFCCGPCSVQSIKNGLVYMKYDTPFIFAEVNSDKVYWQ
RQDDGSFKIVYVEEKAIGSLIITKAIGSNMREDITHTYKHPEGSEAERKAVETAAAHGSK
PNVYATRDSTEDVAMQVEAQDAVMGQDLTVCVVLTNRSSSPRTVKLHLYLSVTFYTGVTG
SVFKESKKEVVLAPGASERVTMPVAYKEYRAQLVDQGAMLLNVSGHVKENGQVLAKQHTF
RLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGG
NETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAGGGGAFSDIRGSGRSRE
TIPMASRGGA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgccaacaccttcatcagggggtcctcgctcggatgtcggccgctggggtgga
aacccctggcagccccccaccaccccttctccagagccggaaccagagccagacagacgt
tctcgccgcgggggccgatccttctgggctcgctgctgtggctgctcccggggttcagac
tcccgccggcctggctcccggggcagcgctgtgaacgcagctggagatggcaccatccgg
gagggaatgctggtggtcactggcatggatctgctgagttcacgctcagaccagaaccgc
cgagagcaccacacagacgagttcgagtacgatgagctgattctccgccgtgggcagcct
ttccatatggtcctcttcctgtctcgtccctatgagtcctccgatcatgtcaccctggag
ctgtgcatcggaaacaatcccgaggtgggcaagggcacccacgtgatcatcccggtgggc
aaggggggcagtggaggctggaaggcccaggtgaccaagtccagtgggcagaatctgaac
ctgcgggtccacacctcccccaacgccatcatcggcaagtttcagttcaccgtccgcaca
cgctgcaaagctggagagttccaactgccctttgacccccgcaacgagatctacatcctc
ttcaatccctggtgccccgaggacatcgtgtatgtggaccatgaggactggcggcaggag
tatgtgcttaatgagtctgggcgaatttactatgggacagaagcgcagattggcgagcgg
acctggaactacggccagtttgaccacggggtgctggacgcctgcctgtacatcctcgat
cggcggggcatgccctatggaggccgcagggaccccgtcagtgtctcccgggtcatctct
gccatggtgaactccttggatgacaatggggtcctgattgggaactggtctggagattat
tcccgcggtaccaacccatcagcatgggtgggcagcgtggagatccttctcagctaccta
cgcaccggcaactctgtccccttcggccagtgctgggtcttcgccggtgtgactaccaca
gtgctgcgctgcctgggcctggccacccgtactgtcaccaacttcaactccgcgcacgac
acagacacttccctcaccatggacatctactttgatgagaacatgaagcccctggagcac
ctgaaccatgattctgtctggaacttccacgtgtggaatgactgttggatgaagaggcca
gatctgccctcaggcttcgatgggtggcaggttgtggacgccacaccccaggagaccagc
agtggcatcttctgctgtgggccctgctctgtgcagtccatcaagaatggcttggtctac
atgaagtacgacacacccttcattttcgcagaggtaaacagtgacaaagtttactggcag
cgacaggatgacggcagcttcaagatcgtgtatgtggaggagaaggccatcggctcactc
atcattacaaaggctatcggctccaacatgcgggaagacatcacgcacacctataagcac
ccagaaggctcagaagcagagcggaaggcagtggagaccgcggccgcccacggcagcaaa
cccaacgtgtacgccacgcgggactcgacggaggatgtggccatgcaggtggaggcgcag
gacgcagtgatggggcaggacctgacggtctgcgtggtgctgaccaaccgcagcagcagc
ccccgcactgtgaagctgcacctctacctctctgtcaccttctacaccggcgtcacggga
tccgtcttcaaggagagcaagaaggaggtggtgctggcgccgggggcctcggagcgcgtg
accatgcccgtggcctacaaggaataccgggcccagcttgtagaccagggagccatgctg
ctcaacgtctcaggccacgtgaaggagaacgggcaggtgctggccaagcagcacaccttc
cgtctgcgtaccccagacctcagtctcacgttactgggagcagctgtggttggccaggag
tgcgaagtacagattgtcttcaagaacccgctgcctgtcaccctcaccaacgtcgtcttc
cggctcgagggctccgggttgcagaggcccaagatcctcaatgttggggacattgggggc
aacgagacagtgaccctgcgccagacgtttgtgcctgtgagaccaggtccccgccagctc
attgccagcttggatagcccacagctctcccaggtgcacggggtcatccaggtggacgta
gccccagccggcggaggcggggccttctcagacattagaggcagcggtcgctcacgggag
accatccccatggcctctcgaggtggggcttag

DBGET integrated database retrieval system