KEGG   Capra hircus (goat): 102178690Help
Entry
102178690         CDS       T02910                                 

Gene name
KAT8
Definition
K(lysine) acetyltransferase 8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102178690 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
25
AA seq 300 aa AA seqDB search
MDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMK
YEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYF
DVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYE
LSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIIS
TLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggatcccacaacagcagccttggagaaggaacatgaggcgatcaccaaggtgaagtac
gtggacaagatccacattgggaactacgaaatcgatgcctggtacttctccccattccct
gaagactatgggaaacagcccaagctctggctctgcgagtactgtctcaagtatatgaaa
tatgagaagagctaccgcttccacttgggccagtgccagtggcggcaacccccgggaaag
gagatctaccgcaagagcaacatctctgtgtatgaagtggatggcaaagaccacaagatt
tactgtcagaacctgtgtctgctggccaagctcttcctggaccataagacgctatacttt
gacgtggagccattcgtcttttacatcttgaccgaggtggacaggcagggggcccacatc
gtcggctacttctcaaaggagaaggagtccccagatgggaacaatgtggcctgcatcctg
acgctgcccccctaccagcgccgtggctacgggaagttcctcatagctttcagctatgag
ctctcaaagctggagagcacggtcggctcccctgagaagccactgtctgacctgggcaag
ctcagctaccgcagctactggtcctgggtcctgctggagatcttgcgagacttccggggc
accctgtccatcaaggaccttagccagatgacgagcatcactcagaatgacatcattagc
accctccagtccctcaacatggttaagtactggaagggccagcacgtgatctgtgtcaca
cccaagctggtggaggaacacctcaaaagtgctcagtataagaaaccacccatcacagtg
gactctgtctgcctcaagtgggcaccccccaagcacaagcaagtcaaactttccaagaag
tga

DBGET integrated database retrieval system