KEGG   Capra hircus (goat): 102180115Help
Entry
102180115         CDS       T02910                                 

Gene name
MAOB
Definition
(RefSeq) monoamine oxidase B
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
chx  Capra hircus (goat)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102180115 (MAOB)
   00330 Arginine and proline metabolism
    102180115 (MAOB)
   00340 Histidine metabolism
    102180115 (MAOB)
   00350 Tyrosine metabolism
    102180115 (MAOB)
   00360 Phenylalanine metabolism
    102180115 (MAOB)
   00380 Tryptophan metabolism
    102180115 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102180115 (MAOB)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102180115 (MAOB)
   04726 Serotonergic synapse
    102180115 (MAOB)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    102180115 (MAOB)
   05031 Amphetamine addiction
    102180115 (MAOB)
   05034 Alcoholism
    102180115 (MAOB)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102180115 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
X
AA seq 520 aa AA seqDB search
MSSKCDVVVVGGGISGMAAAKLLHDSGLNVIVLEARDRVGGRTYTLRNQKVKYVDLGGAY
VGPTQNRILRLSKELGLETYKVNEVERLIHHTKGKSYPFRGSFPSVWNPIAYLDHNNLWR
TMDDMGREIPSDAPWKAPLAEQWDLMTMKELLDKICWTESSKQLAILFVNLCVSAEIHEV
SALWFLWYVKQCGGTTRIFSTSNGGQERKFVGGSGQVSERIMELLGDRVKLERPVIHIDQ
TGENVLVETLNHELYEAKYVISAVPPVLGMKIHFNPPLPMMRNQLITRVPLGSVIKSIVY
YKEPFWRNMDYCGSMIIEGEEAPVAYTLDDTKPDGSYPAIIGFILAHKARKLARLTKEER
LKKLCDLYAKVLGSQEALHPVHYEEKNWCEEQYSAGCYTSYFPPGIMTQYGRVLRQPVGR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWLPEPESVDVPAKPITTT
FLQRHLPSVPGLLKLIGLTTIISATALGYLAHKRGLLVRI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaaatgcgacgtggtcgtggtggggggcggcatctcaggtatggcagcagcc
aaacttctgcatgactctggcctgaatgtgattgttctggaagcccgggaccgcgtggga
ggcaggacttacacccttaggaaccaaaaagttaaatatgtggaccttggaggagcttat
gttgggccaactcagaatcgtatcttaagattatccaaggaactaggattggaaacctac
aaagtgaatgaagtagagcgtctgattcaccatacaaagggcaaatcctaccccttcagg
ggctcattcccatctgtgtggaatcctattgcctacctagatcataacaacctctggagg
acgatggatgacatgggacgagagattcccagtgatgctccgtggaaggcaccccttgca
gaacagtgggacctgatgacaatgaaggagttgctggacaagatctgctggacagaatct
tcgaagcagcttgctattctctttgtgaacctttgcgtctccgcagagatccatgaggtc
tccgctctctggttcctatggtatgtgaagcagtgtgggggcacgaccaggatcttctca
acatccaatggagggcaggagaggaaatttgtgggtggatctggtcaagtgagtgagcgg
ataatggaactcctgggggatcgagtgaagctggagaggcctgtgatccacattgaccag
acaggagaaaatgtccttgtggagaccctaaaccatgaattgtatgaggctaagtacgtg
attagtgctgttcctcctgttctaggcatgaagattcacttcaatccccctctgccaatg
atgagaaatcaactgatcactcgtgtgcctttgggttcagtcatcaagagtatagtttat
tataaagagcccttctggagaaatatggattactgtggaagcatgattattgaaggagag
gaagctccagttgcctatacattggatgatactaaacctgatggcagctatcctgccata
ataggatttatccttgcccacaaagccagaaaactggcccgtcttactaaggaggaaagg
ttgaagaaactctgtgacctctatgcaaaggttctgggctcacaagaagctttgcaccca
gtgcactatgaagagaagaactggtgtgaggagcagtactcagcaggttgctacacttcc
tacttccctcctgggatcatgactcaatatggaagggttctacgccagccagtgggcagg
atttacttcgcaggcacagagactgccacacactggagtggctacatggagggggctgtg
gaggctggcgagagagcggcccgagagatcctgcatgccatgggcaagatcccagaggat
gaaatctggctgcctgaaccagagtctgtggatgtccctgcgaagcccatcaccaccacc
ttcttgcaaaggcatttgccctccgtgccaggcctgctgaagctgattggattgaccacc
atcatttcagcaactgctctcggctacctggcccacaagagggggctcctggtgcgaatc
taa

DBGET integrated database retrieval system