KEGG   Capra hircus (goat): 102180125Help
Entry
102180125         CDS       T02910                                 

Gene name
ELP3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102180125 (ELP3)
Transfer RNA biogenesis [BR:chx03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102180125 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 547 aa AA seqDB search
MRQKRKGDLSPAQLMMLTIGDVIKQLIEAHEQGKDIDLNKVKTRTAAKYGLSAQPRLVDI
IAAVPPQHRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELVGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGP
YMVKTLE
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaagcgcaaaggagatctcagccctgctcagctaatgatgctgaccatagga
gatgttattaaacaactaattgaagctcacgaacaggggaaagacatcgatctaaataag
gtgaagaccaggacagctgccaaatatgggctctcggcgcagcctcgcctggtggacatc
atcgctgcggtcccgcctcagcatcggaaggtcttggtccccaagctcaaggcaaaaccc
atcagaactgccagtgggattgctgttgtggctgtcatgtgcaaaccccacagatgtcca
cacatcagttttacaggaaatatatgtgtgtactgccctggcggacctgattcagatttc
gaatattccacccagtcttacactggatatgagccaacctccatgcgagctatccgtgcc
agatatgacccttacctgcagacaagacaccggatagaacagttaaaacaacttggtcac
agtgtggataaagtggaatttatcgtgatgggtggaacatttatggcccttccagaagaa
tacagagattattttattcgaaatttacacgatgccttatcaggacatacctccaacaat
atttatgaggccgtcaagtattctgagagaagcctcacaaagtgcattggaattactatt
gagaccagaccagattactgcatgaagcggcatctcagtgacatgttgacctatggctgc
acaaggctggagattggggtgcagagtgtctatgaggatgtggccagagataccaaccgg
ggccacactgtgaaggcagtgtgcgagtccttccacctggccaaagattctggcttcaaa
gtggtggctcacatgatgcctgatctgccgaacgtggggctggagagagacattgaacag
ttcacagagtttttcgagaacccagctttccgtcctgacggtttgaaactctacccgacc
ctggtgattcgtgggacagggctctatgagctgtggaagtcaggaagatacaagagttac
tccccgagcgacctgatcgaattggtagcccggatcctggccctcgtgcccccgtggact
cgagtgtaccgcgtgcagagagatattccaatgccattagtcagctcaggagtggagcac
ggaaacttgagagagctggcgtttgcaagaatgaaagaccttggaatacagtgtcgtgat
gtgagaaccagagaggttggaatccaagaaattcatcacaaagtccggccataccaggtt
gaattggtgagaagagattatgttgcaaatggaggctgggaaaccttcctatcgtacgaa
gacccagatcaggacatcttgattggcctcttgagattacggaagtgttcagaggagaca
ttccgtttcgaattggttgggggtgtgtccatagtccgagagctgcacgtgtacggaagt
gtggtccccgtaagcagtcgggatcccactaaatttcagcatcagggctttggcatgctg
ctgatggaggaagcagaacgaatagccagagaagaacatggatctgggaaaatagccgtt
atatcaggggtcggcaccaggaactattacagaaagattggctacagattgcaaggtcca
tacatggtaaagacgctagagtaa

DBGET integrated database retrieval system