KEGG   Capra hircus (goat): 102180159Help
Entry
102180159         CDS       T02910                                 

Gene name
TGM7
Definition
transglutaminase 7
Orthology
K05623  
transglutaminase 7 [EC:2.3.2.13]
Organism
chx  Capra hircus (goat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 710 aa AA seqDB search
MDEVAALELRSVDLQSAKNNQEHHTQEMGLQRLIVRRSQSFTIQLHFNRPFHSKKDSITF
VAETGPAPKELLGTRATFLLTQARQGNGWSASDFTVHANSLYVSLFTPPSAVIGPYSLKI
EISQGPSHSTTHPLGTFILLFNPWSAEDDVYLPSETLLQEYIMMDYGFVYKGHERFITPW
PWNYGQFEEDIIDICFEILNKSLYFLKNPSKDYSQRNDVVYICRVVSAMINSNDDSGVLQ
GNWGEDYSRGVSPLEWTGSVAILRQWAARGGQPVKYGQCWVFAAVMCTVMRCLGVPTRVV
SNFRSAHNSDANLTIDTYYDQHAEMLPTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFRCGPASVKAIREGEIHLPYDTPFVYAEVNADEVVWLLKDGQAQEILAH
NTSSIGKEISTKMVGSDQRENITSSYKYPEGSPEERSVFMKASQKMLGVRRTSSPFLDLL
ESGGAVGQPAQLQLHLTRKPEWGQDLLLKLHARRVADRAHPQGPIHLVVDFCAQTLLHNG
GTRKPLWRQKVHLTLDFGEDIQWPLSLPYNNYRNKLTDEKLIRVSGIAKVEETGRSMLVL
KDISLEPPHLSIEVSERAEVGKALRVHISLTNTLSVPLSHCTMVLEGSGLVSGQISNDLG
TLVAGHTIKIQVDLYPIKAGSRQLQVLVSSNEIKEIKGYKDIFVAAARAP
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggtggcagccttggagctcaggtccgtcgacctgcagagcgccaagaacaac
caggagcatcacacacaggagatgggcctccagcggctcatcgtgcgccgtagccagtcc
ttcaccatccagctgcatttcaaccgccccttccactcgaagaaggactccatcaccttt
gtggctgagacaggaccagcacccaaggagcttctgggaacccgagccaccttcttgctc
acccaagcccgacaaggcaatggctggagtgcttctgacttcaccgttcatgccaactcg
ctctatgtctccctttttacaccacccagtgcagtcattggtccctactctctgaagata
gagatctctcagggcccaagtcatagcacgacccaccctctggggaccttcatcctactt
tttaacccttggagtgcagaggacgacgtctacctgccaagtgaaacgctgctgcaggag
tatatcatgatggactatggctttgtttacaagggtcatgaacgattcatcaccccctgg
ccctggaactacgggcagtttgaagaggacatcatagatatctgctttgagattctgaac
aagagcctgtacttcttaaagaacccgtccaaagactactcacagcggaacgacgtggtg
tacatctgcagggtggtgagcgccatgatcaacagcaacgacgacagcggcgtgctgcag
gggaactggggagaggactactcccggggggtcagccccctggagtggacgggcagcgtg
gccatcctgcggcagtgggcggccaggggcgggcagcctgtgaagtacgggcagtgctgg
gtctttgcagctgtgatgtgtacggtaatgagatgcttaggtgttccaacacgtgttgtt
tccaatttccgttctgcacacaactcggatgcaaacttgaccatcgacacctactatgac
caacatgcagagatgctgccaactcagaagcgagacaaaatatggaatttccatgtctgg
aatgagtgctggatgatccggaaagacctccctccaggatacaacgggtggcaggttctg
gaccccactccccagcaaaccagcagcgggctgtttcgctgtggccctgcctccgtgaag
gccatcagggaaggggagatccacctgccttacgataccccatttgtgtatgccgaggtg
aacgctgatgaagtcgtttggctattgaaggatggccaggcccaggaaatcctggcccat
aacaccagttccatcgggaaggaaatcagcaccaagatggtagggtcagaccagcgcgag
aacatcaccagctcctacaagtacccagaaggatcccctgaggagcgatctgtgtttatg
aaggcctcccagaaaatgctgggtgtacggaggacctcttcaccattcctagatctgttg
gagtctgggggtgctgtgggccagccggcacagctgcagcttcacctgaccaggaagcct
gagtggggccaggacctgctgctgaagctgcatgcccggagggtggcagacagagcccac
ccccaggggcccatccacctggtggtggacttctgtgcacagactctgctgcacaacggt
ggtacccggaagcccctctggagacagaaagtgcacttgaccctggactttggggaggat
atacagtggccgctctcactaccttacaacaattacagaaacaagctgacggatgaaaag
ctgatccgtgtgtctggcattgccaaagtggaggagacagggaggtccatgctagtttta
aaagatatctccctggagcctccccacttatctattgaggtgtctgagagggctgaggtg
ggcaaggcactgagagtccacatctcactcaccaacaccctctcggtgcctctgagtcac
tgcacaatggtgctggagggcagtggcctcgtcagcgggcagatatcaaatgaccttggg
actctggtggccggacacactatcaaaattcaagtggacctctaccccatcaaagccgga
tcccgccagctccaagtcctcgtcagcagcaacgagatcaaagagattaagggatacaag
gacatctttgttgctgcagccagggctccttga

DBGET integrated database retrieval system