KEGG   Capra hircus (goat): 102181832Help
Entry
102181832         CDS       T02910                                 

Gene name
POR
Definition
(RefSeq) P450 (cytochrome) oxidoreductase
  KO
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     102181832 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
25
AA seq 680 aa AA seqDB search
MNMGDSNMDTGTTLPETVAEEVSLFSTTDMILFSLIVGVMTYWFLFRKKKEEVPEFTKIQ
TTTSSVKDRSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYD
LADLSSLPEIEKALAVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFALGNKTY
EHFNAMGKYVDKRLEQLGAQRIFDLGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGE
ESSIRQYELMVHTDMDMAKVYTGEMGRLKSYENQKPPFDAKNPFLAVVTTNRKLNQGTER
HLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLDVIMSLNNLDEESNKK
HPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPAEQEQLRKMASSSGEGKELYLR
WVLEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEY
KTKTGRINKGAATSWLRAKEPAGENGGRALVPMYVRKSQFRLPFKATTPVIMVGPGTGVA
PFIGFIQERAWLRQQGKDVGETLLYYGCRRSDEDYLYREELAGFHKDGTLTQLNVAFSRE
QPQKVYVQHLLKKDKEHLWELIHEGGAHIYVCGDARNMARDVQNTFYDIVAEQGAMEQAQ
AVDYVKKLMTKGRYSLDVWS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgggagactccaacatggataccggcaccaccctgcctgagacggtggctgaa
gaagtgtcccttttcagcacgacggacatgatcctgttttctctcatcgtgggcgtcatg
acatactggttcctcttcaggaagaaaaaagaagaagtccccgagttcaccaagattcag
accacgacctcctctgtcaaagacagaagctttgtggagaagatgaagaagacgggcagg
aacatcatcgtgttctatggctcccagacggggactgctgaggagtttgccaaccgcctg
tccaaggacgcccaccgctatgggatgcggggtatggcagctgaccccgaggagtatgat
ctggccgacctgagcagcctaccagagattgagaaagccctggccgtgttctgtatggct
acctacggtgagggggaccccaccgacaacgcccaggacttctacgactggctccaggag
acggatgtggacctctctggggtcaagtacgcggtgtttgcccttgggaacaagacctac
gagcacttcaacgccatgggcaagtacgtggacaagcggctggaacagctcggggcccag
cgaatctttgatctggggctgggcgacgacgacgggaacctggaggaggacttcatcacg
tggcgagaacagttctggccggccgtgtgcgagcactttggggtggaagccaccggagag
gagtccagcattcgccagtacgaactcatggtccacacggacatggacatggccaaggtg
tatacgggcgagatgggccgcctgaagagctatgagaaccagaaaccccccttcgacgcc
aagaacccgttcctggctgtcgtcaccaccaaccggaagctgaaccagggaaccgagcga
cacctcatgcacctggaattagacatctcagactccaaaatcaggtatgagtctggggac
catgtggctgtttatccggctaatgactctgccctggtgaaccagcttggcgagatcctg
ggtgctgacctggacgtcatcatgtccctgaacaaccttgatgaggagtccaacaagaag
caccccttcccctgccctacctcctaccgcacggccctcacctactacctggacatcacc
aacccaccacgcaccaacgtgctctacgagctggctcagtacgcctcggagcccgccgag
caggagcagctgcgcaagatggcctcctcatcgggcgagggcaaggagctgtacctgagg
tgggtactggaggctcggcggcacatcctggccatcctgcaggactacccatccctgcgg
ccccccatcgaccacctgtgtgagctgctgcctcgtctccaggcccgctactactccatc
gcctcgtcctccaaggtccaccccaactccgtgcacatctgcgccgtggccgtggagtac
aaaaccaagacgggccgcatcaacaagggcgcggccaccagctggctgcgggccaaggag
ccggccggggagaacggcggccgggccctggtgcccatgtacgtgcgaaagtcccagttc
cgcctgcccttcaaggccaccacgcccgtcatcatggtgggccccggcaccggggtcgcc
cccttcataggcttcatccaggagcgggcctggctaaggcagcagggcaaggacgtgggc
gagacgcttctctactacggctgtcggcgctctgacgaggactacctgtaccgcgaggag
ctggctggcttccacaaggacggcaccctcacccagctcaacgtggccttctcccgggag
cagccccagaaggtctacgtgcagcacttgctcaagaaggacaaggagcacctgtgggaa
ctcatccacgaggggggcgcccacatctacgtgtgcggggacgctcggaacatggcaaga
gatgtgcagaacaccttctatgacatcgtggccgagcagggggccatggagcaggcccag
gccgtggactacgtcaagaagctgatgaccaagggccgctactccctggatgtgtggagc
tag

DBGET integrated database retrieval system