KEGG   Capra hircus (goat): 102182142Help
Entry
102182142         CDS       T02910                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102182142 (UCHL3)
Peptidases [BR:chx01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102182142 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 258 aa AA seqDB search
MDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSRGQDVTSSVYFMKQTISNACG
TIGLIHAIANNKDKMHFESGSTLKKFLEESASMSPEERARYLENYDAIRVTHETSAHEGQ
TESSSPSSSQPHSSHCRTKASSLCHHASLPWVKRSHVGPAKATSPSLRLRRWRPFLRLPS
LGLHSVAPNIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKF
MERDPDELRFNAIALSAA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgaactccttagcatggtaccaagaccagtgtgtgcagtgttacttctcttc
cctattacagaaaagtatgaagtattcagaacagaagaagaggaaaaaataaaatctcgg
ggacaagatgttacatcgtcagtatatttcatgaagcaaacaatcagcaatgcctgtggg
acaattggactaatccatgctattgccaacaataaagacaagatgcactttgaatctgga
tcaaccttgaaaaaattcctggaggagtctgcatcaatgagccctgaagaacgagccaga
tacctggagaactatgacgccattcgagttactcatgagaccagtgcccatgaaggtcag
actgagtcctcctcgccatcctcatcacagcctcattctagccactgcagaacgaaggcc
tcatcattgtgtcaccatgcatccctgccctgggtcaaacgtagccatgtaggccctgca
aaggctaccagtccatctcttcgtcttcgtcgctggcgacccttcttacgtctgccatct
ttgggtctccattctgttgcaccaaatatagatgaaaaagtagatcttcattttattgca
ttagttcatgtagatgggcatctctatgaattagatggacgaaaaccatttccaattaac
catggggaaactagtgatgaaactttattagaggatgccatagaagtttgcaagaagttt
atggaacgtgaccctgatgaactgagattcaatgccattgctctttctgcagcatag

DBGET integrated database retrieval system