KEGG   Capra hircus (goat): 102184382Help
Entry
102184382         CDS       T02910                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102184382 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102184382 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102184382 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    102184382 (KAT2B)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102184382 (KAT2B)
Transcription machinery [BR:chx03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102184382 (KAT2B)
Chromosome [BR:chx03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102184382 (KAT2B)
   HAT complexes
    PCAF complex
     102184382 (KAT2B)
    STAGA complex
     102184382 (KAT2B)
    TFTC complex
     102184382 (KAT2B)
    SAGA complex
     102184382 (KAT2B)
    SLIK complex
     102184382 (KAT2B)
    ADA-HAT complex
     102184382 (KAT2B)
    HAT-A2 complex
     102184382 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 813 aa AA seqDB search
MSEAGGPAPGAPPLPPAPPQGPPGATAGGAGSCGPAAAGAAAGAAEGPGGGCSARIAVKK
AQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSC
SHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHREEDADTKQVYFYLFKLLRKSIL
QRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPPKERQTIVELAKMFLNRINYWH
LEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETAQVFGRTLLRSVFTVM
RRQLLEQARQEKDKLPPEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQL
GIQTVISPPPVAGTVSYNSSSASLEQQNGGSTSPSCRGASGLEANPGEKRKMSDSHVLEE
TKKPRVLGDIPPELIREAMSAITDPAATLAPETSFLSAHSARDEAARLEERRGVIEFHVV
GNSLSQKPNKKVLMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGIC
FRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKK
QGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQA
QIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGREKSKEARDPDQLYSTLRSILQQV
KSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNC
KEYNPPESEYYRCANVLEKFFFSKIKEAGLIDK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggcgggcgggcccgcgcccggggcgcccccgctgccccccgcgcccccgcag
ggccccccgggcgcgacggccgggggcgcgggctcctgcgggccggccgcggcgggggcg
gcggcgggcgcggccgagggcccgggcggcggctgctcggcccggatcgccgtgaagaag
gcgcagctgcgctccgccccgcgggccaagaagctggagaaactcggggtgtactccgcc
tgcaaggcagaggaatcttgtaagtgcaatggctggaaaaaccccaatccctcgcccacg
ccccccagagccgacctgcagcagatcatcgtcagcctcacggagtcctgccggagctgc
agccacgccctcgctgctcacgtgtcccacctggagaacgtgtccgaggaggagatgaac
agactgctggggatcgtgctggatgtggagtacctctttacctgtgtccacagggaagaa
gatgccgacaccaagcaggtttatttctacctgttcaagctcttgaggaagtctatttta
caaagaggaaaacctgtggttgaaggttctttggagaagaagcccccttttgaaaaacct
agtattgaacagggtgtgaataactttgtacagtacaaattcagtcacctgccacccaaa
gaaaggcaaacgatcgttgagctggcaaaaatgttcctgaaccgcatcaactattggcac
ctggaggcaccgtctcagcgaagactgcgctctcccaacgacgacatctctggctacaag
gagaattacaccaggtggctgtgttactgcaacgtcccccagttctgcgacagcctgccg
cggtacgagacggcccaggtgtttgggaggacgctgctgcgctctgtcttcactgtgatg
cggcggcagctgctggagcaggcgaggcaggagaaggacaagctgccgccggagaagcgg
actctgatcctcacgcacttcccgaagtttctgtccatgttagaagaagaagtttatagt
caaaactctcccatctgggatcaggattttctctcagcttcttccagaaccagccagctt
ggaatccaaacagttatcagtccacctcctgtggccgggacagtttcctacaattcgagt
tccgcttcccttgagcagcagaacggagggagcaccagcccatcctgtcgaggcgcgtcc
gggcttgaggcaaacccaggagaaaagaggaaaatgagcgactcccatgttttggaggag
accaagaagccccgggtgctgggcgacatcccaccggagctgatccgcgaggccatgtcc
gccatcacagaccccgcggcgacgctggcgccggagaccagctttctgtcggcacactcg
gccagggacgaggcggccaggctggaggagcgcaggggtgtgatcgagttccacgtggtg
ggcaactccctgagccagaagcccaacaagaaggtgctcatgtggctggtggggctgcag
aacgtgttctcgcaccagctgccgcgtatgcccaaggagtacatcacccggctcgtcttc
gacccgaaacacaaaacccttgctttaattaaagatggccgtgtcattggcggtatctgc
ttccggatgtttccgtcccagggcttcacagagattgttttctgcgcggtaacctctaat
gaacaagtcaagggctatggaacacacctgatgaaccacttgaaggaataccacataaaa
cacgacatcctgaacttcctcacctacgcagatgaatatgcaattgggtatttcaagaag
cagggtttctccaaagaaattaaaatccctaaaaccaaatatgttggctacatcaaggat
tatgaaggcgccactttaatgggatgtgagctaaatccacggatcccgtacacggagttc
tctgtcatcattaagaagcagaaggagatcattaaaaagctgatagaaagaaaacaagcc
cagattcggaaagtctacccgggactttcctgttttaaagatggagttcggcagatcccg
atagaaagcattcctggaattcgagagacaggctggaagccgagtggaagagagaaaagt
aaagaggccagagaccccgaccagctgtacagcacgctcaggagcatcctgcagcaggtg
aagagccatcaaagcgcttggcccttcatggaacccgtgaagagaacagaagctccggga
tattatgaagttataaggttccccatggatctgaaaaccatgagtgagcgcctcaagaat
aggtactacgtgtctaagaagctgttcatggcagacttgcagcgagtctttaccaattgc
aaggagtacaacccccctgaaagcgagtactacaggtgcgccaatgtcctggagaaattc
ttcttcagtaagatcaaggaagctgggctaattgacaagtga

DBGET integrated database retrieval system