KEGG   Capra hircus (goat): 102184470Help
Entry
102184470         CDS       T02910                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102184470 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102184470 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102184470 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    102184470 (KAT2A)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102184470 (KAT2A)
Transcription machinery [BR:chx03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102184470 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 705 aa AA seqDB search
MDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTD
TKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQT
MFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYET
THVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSP
IWESGFTMPPSEGTQLVPRPATVSAAVVPSAPIFSPTMGGSSNSSLSLDSGGAEPMPGEK
RKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLE
ERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVVFSHQLPRMPKEYIARLVFDPKHKTLA
LIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSILYFLT
YADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQK
EIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQ
LYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKL
FVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcagcagccagcggcgaacctaagcgagctgtgccgcagctgtgagcaccct
ttggctgaccacgtgtcccacctggagaacgtgtcggaggatgagattaaccggctgctg
gggatggtggtggacgtggagaatctgttcatgtctgttcataaggaggaggacacggac
accaagcaggtctatttctacctcttcaagctcctgcgaaaatgcatcctgcagatgacc
cggcctgtggtggaggggtccctgggcagccccccatttgagaagcctaatattgagcag
ggcgtgctaaactttgtgcagtacaagtttagtcacctggctccccgggagcggcagacg
atgttcgagctctcaaagatgttcctgctctgccttaactactggaagcttgagacacct
gcccaatttcggcagaggtctcaggccgaggatgtggctacctacaaggttaattacacc
agatggctctgctactgccacgtgccccagagctgcgatagcctcccccggtatgagacc
actcatgtcttcgggcgcagccttctccgctccatcttcacggttacccggcgacagctg
ctagagaagttccgagtagagaaggacaagctggtgcccgagaagaggaccctcatcctc
acccacttccccaaattcctgtccatgctggaggaggagatctatggggcaaactctccg
atctgggagtcgggcttcaccatgccgccctcagagggaacacaactggtgccccggcca
gctacagtcagcgctgcagttgttcccagtgcccccatcttcagccccaccatgggtggg
agcagcaacagctccttgagcctggattctggaggcgctgagcccatgccaggcgagaag
aggaagctcccagagaacctgaccctggaggacgccaagcggctccgtgtgatgggtgac
atccccatggagctggttaatgaggtcatgctcaccatcaccgaccctgccgccatgcta
gggcccgagacgagcctgctgtcggccaacgccgcccgggatgagactgctcgcctggaa
gagcgccgaggcatcattgagttccacgtcattggcaactcgctcacacccaaggccaat
cggcgggtgttgctgtggctggtggggctacagaatgtcgtcttctcccaccagctgccg
cgaatgcccaaggagtatattgcccgcctcgtcttcgacccgaagcacaagactctggcc
ttgatcaaggacgggcgggtcattggtgggatttgcttccgcatgtttcccacccagggc
ttcacggagatcgtcttctgtgctgtcacctccaatgagcaggtcaagggctatggcact
cacctgatgaaccacctgaaggagtatcacatcaagcacagcattctctacttcctcacc
tacgccgacgagtacgccatcggctacttcaagaagcagggcttctccaaggacatcaag
gtgcccaagagccgctacttgggctacatcaaggactacgagggtgcgacactgatggag
tgtgagctgaaccctcgaatcccctacacagagctgtcccacatcatcaagaagcagaag
gagatcatcaagaagctgattgagcgcaaacaggcccagatccgaaaggtctatcccggg
ctcagctgcttcaaggagggtgtgcgccagatccctgtggagagcgtccctggcattcga
gagacaggctggaagccactggggaaggagaaagggaaggagttgaaggaccctgaccag
ctctacacaaccctcaaaaacctgctggcccagatcaagtcccaccccagtgcctggcct
ttcatggagcccgtgaagaagtcagaggccccagactactacgaggtcatccgcttcccc
atcgacctgaagaccatgacagagaggctgcgcagccgctactatgtgacccggaagctc
tttgtggccgacctgcagcgggtcattgccaactgccgcgagtacaaccccccggacagc
gagtactgccggtgcgccagcgccctggagaagttcttctacttcaagctcaaggagggc
gggctcattgacaagtag

DBGET integrated database retrieval system