KEGG   Capra hircus (goat): 102185042Help
Entry
102185042         CDS       T02910                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04210  Apoptosis
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04218  Cellular senescence
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04380  Osteoclast differentiation
chx04510  Focal adhesion
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04611  Platelet activation
chx04620  Toll-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  Jak-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04668  TNF signaling pathway
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04725  Cholinergic synapse
chx04750  Inflammatory mediator regulation of TRP channels
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04926  Relaxin signaling pathway
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease (NAFLD)
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04960  Aldosterone-regulated sodium reabsorption
chx04973  Carbohydrate digestion and absorption
chx05100  Bacterial invasion of epithelial cells
chx05142  Chagas disease (American trypanosomiasis)
chx05146  Amoebiasis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  HTLV-I infection
chx05167  Kaposi's sarcoma-associated herpesvirus infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05222  Small cell lung cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05418  Fluid shear stress and atherosclerosis
Module
chx_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102185042 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    102185042 (PIK3CB)
   04015 Rap1 signaling pathway
    102185042 (PIK3CB)
   04012 ErbB signaling pathway
    102185042 (PIK3CB)
   04370 VEGF signaling pathway
    102185042 (PIK3CB)
   04630 Jak-STAT signaling pathway
    102185042 (PIK3CB)
   04668 TNF signaling pathway
    102185042 (PIK3CB)
   04066 HIF-1 signaling pathway
    102185042 (PIK3CB)
   04068 FoxO signaling pathway
    102185042 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102185042 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102185042 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102185042 (PIK3CB)
   04024 cAMP signaling pathway
    102185042 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102185042 (PIK3CB)
   04152 AMPK signaling pathway
    102185042 (PIK3CB)
   04150 mTOR signaling pathway
    102185042 (PIK3CB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102185042 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    102185042 (PIK3CB)
   04218 Cellular senescence
    102185042 (PIK3CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102185042 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102185042 (PIK3CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102185042 (PIK3CB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102185042 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102185042 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102185042 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102185042 (PIK3CB)
   04660 T cell receptor signaling pathway
    102185042 (PIK3CB)
   04662 B cell receptor signaling pathway
    102185042 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102185042 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102185042 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102185042 (PIK3CB)
   04062 Chemokine signaling pathway
    102185042 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    102185042 (PIK3CB)
   04923 Regulation of lipolysis in adipocyte
    102185042 (PIK3CB)
   04915 Estrogen signaling pathway
    102185042 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102185042 (PIK3CB)
   04917 Prolactin signaling pathway
    102185042 (PIK3CB)
   04926 Relaxin signaling pathway
    102185042 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102185042 (PIK3CB)
  Digestive system
   04973 Carbohydrate digestion and absorption
    102185042 (PIK3CB)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102185042 (PIK3CB)
  Nervous system
   04725 Cholinergic synapse
    102185042 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102185042 (PIK3CB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102185042 (PIK3CB)
  Development
   04360 Axon guidance
    102185042 (PIK3CB)
   04380 Osteoclast differentiation
    102185042 (PIK3CB)
  Aging
   04211 Longevity regulating pathway - mammal
    102185042 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102185042 (PIK3CB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102185042 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102185042 (PIK3CB)
   05231 Choline metabolism in cancer
    102185042 (PIK3CB)
   05205 Proteoglycans in cancer
    102185042 (PIK3CB)
   05203 Viral carcinogenesis
    102185042 (PIK3CB)
   05210 Colorectal cancer
    102185042 (PIK3CB)
   05212 Pancreatic cancer
    102185042 (PIK3CB)
   05225 Hepatocellular carcinoma
    102185042 (PIK3CB)
   05226 Gastric cancer
    102185042 (PIK3CB)
   05214 Glioma
    102185042 (PIK3CB)
   05221 Acute myeloid leukemia
    102185042 (PIK3CB)
   05220 Chronic myeloid leukemia
    102185042 (PIK3CB)
   05218 Melanoma
    102185042 (PIK3CB)
   05211 Renal cell carcinoma
    102185042 (PIK3CB)
   05215 Prostate cancer
    102185042 (PIK3CB)
   05213 Endometrial cancer
    102185042 (PIK3CB)
   05224 Breast cancer
    102185042 (PIK3CB)
   05222 Small cell lung cancer
    102185042 (PIK3CB)
   05223 Non-small cell lung cancer
    102185042 (PIK3CB)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102185042 (PIK3CB)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102185042 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102185042 (PIK3CB)
   04931 Insulin resistance
    102185042 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102185042 (PIK3CB)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    102185042 (PIK3CB)
   05166 HTLV-I infection
    102185042 (PIK3CB)
   05162 Measles
    102185042 (PIK3CB)
   05164 Influenza A
    102185042 (PIK3CB)
   05161 Hepatitis B
    102185042 (PIK3CB)
   05160 Hepatitis C
    102185042 (PIK3CB)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102185042 (PIK3CB)
   05169 Epstein-Barr virus infection
    102185042 (PIK3CB)
   05165 Human papillomavirus infection
    102185042 (PIK3CB)
   05146 Amoebiasis
    102185042 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    102185042 (PIK3CB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    102185042 (PIK3CB)
   01524 Platinum drug resistance
    102185042 (PIK3CB)
   01522 Endocrine resistance
    102185042 (PIK3CB)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102185042 (PIK3CB)
Membrane trafficking [BR:chx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102185042 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381 DUF4135
Motif
Other DBs
NCBI-GeneID: 102185042
NCBI-ProteinID: XP_017905388
Position
1
AA seq 1070 aa AA seqDB search
MCFYFMMPPAMADVLDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISCIKQMLW
KQVTNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKHTYPPEL
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHSLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMVAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHIWNEPLEFDINTCDLPRMTRLCFAVYAVLDKVKTKKSTKTM
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPHALPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttctacttcatgatgcctcctgctatggcagacgtccttgacatctgggcagtg
gactcacagatagcatctgatggctccatacccgtggattttcttttgcccactgggatt
tatatccagttggaggtgcctcgtgaagctaccatttcctgtattaagcagatgttatgg
aaacaagttaccaattacccaatgtttaacctccttatggaaatcgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcagattcagtgaggaaaagatt
cagtcgcttgtgggattatcttggatggattggctaaagcatacctatccacctgagctt
gaaccatccatccctgaaaatttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagttttcaggtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtctaactattcatgggaaagaagatgaa
gttagcccttatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cactcgctaattcagttccagtatatccggaactgtgtgatgaacagaacattgccccat
tttatacttgtggagtgttgcaagatcaagaagctgtatgaacaggaaatggttgccata
gaggctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaatcctttccaaattgtcttggttaaagga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggccggcctttttcatggt
accgaactcctgtgtaaaactgttgtaagctcagagatatcagggaagaatgatcatatt
tggaatgaaccactggaatttgatatcaatacttgtgacctgccacgaatgactcgatta
tgttttgctgtttatgcagttttggataaagtgaaaactaagaaatcaactaaaaccatg
aatccctctaagtatcagaccatcaggaaatctggaaaagtgcattatcctgtagcctgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagatataatactacac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatacagaaaatgcaacagctttgcacataaaattcccagagaataaaaaa
caaccttattactatcctcccttcgataagattattgaaaaagcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatccattgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacacgcattgccgaaattgctgctgtcgatc
aagtggaataaacttgaggatgttgctcagcttcaagcactgcttcagatttggcctaaa
ctgcccccccgggaggcccttgagcttctagatttcaattatccagatcagtatgtacga
gaatatgcggtgggctgcctacaacagatgagtgatgaagaactctctcagtatctttta
cagttggtgcaagttttaaaatatgagccttttcttgattgtgccttgtctagattccta
ctagaaagagcacttgctaatcggaggatagggcagtttttattttggcacctcagatct
gaagtacacattcctgctgtttcagtacaatttggtgttatccttgaagcgtactgccgg
ggaagcgtaggtcacatgaaagcgctttctaagcaggttgaagcactcaataaactaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctaaatagagccaaagggaaagaa
gcaatgcatacttgtctaaaacagaatgcttaccgtgaagccctctctgacctgcagtca
cctctgaacccatgtgttatcctctcagaactctatgttgagaagtgtaaatacatggat
tccaaaatgaagcctttgtggcttgtgtacaacaacaaggtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaggatatgttgacactccaaatgctg
cgcttgatggatttactttggaaagaagctggtctggaccttcggatgctaccttatggc
tgcttagcaacaggagaccgttctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctatcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acttatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaaatttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgccggcatgggaatctcttc
atcacgctgtttgcactgatgttgactgcagggcttcctgagctcacctcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
ttcaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtcaattggatg
gcccacacagttcggaaagactacagatcttaa

DBGET integrated database retrieval system