KEGG   Capra hircus (goat): 102185477Help
Entry
102185477         CDS       T02910                                 

Gene name
TGM2
Definition
transglutaminase 2
Orthology
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
chx  Capra hircus (goat)
Pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    102185477 (TGM2)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102185477 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 687 aa AA seqDB search
MAEDLVLERCDLELEVNGCDHHTADLCRERLVVRRGQPFWLTLHFEGRNYEASVDSLTFC
AMTGPDPSEETGTKALFRLSDAMEEGAWAAVVVDQQDSTLSLQFSTPANAPIGHYRLSLE
ASTGYQGSSFMLAQFTLLFNSWCPADAVYLNSDEERQEYVLTQQGFIYQGSAKFIKSIPW
NFGQFEDGILDICLMLLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMFWIGSVDILRRWKKDGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEYGEIQSDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQDDGSLHKSINHSL
VVGLKISTKSVGRDDREDITHNYKYPEGSPEEREAFTRANHLNKLVDKEETGVAMRIRVG
EGMNRGCDFDVFAHITNSTPEEHTGRLLLCARTVSYNGILGPECGTKDLLSLSLEPYSEK
SIPLRILYEKYCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEVSLRNPLTEALSGCTFTVEGSGLIEGQKTVDAPDPVEAGEEVKVRVDLLPLYVG
RHKLVVNFESDRLKAVKGFRNVIVGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctggtcctggagagatgtgacctggagctggaggtcaatggctgtgac
caccacacagctgacctgtgcagggagaggctggtggtgcggcggggccagcccttctgg
ctgactctgcacttcgagggccgaaactatgaggccagtgtggacagcctcaccttctgt
gccatgactggcccagaccccagtgaggagaccgggaccaaggcccttttcaggctgtct
gatgctatggaggagggggcctgggcagcggtggtagtggaccagcaagacagcaccctc
tcgctgcagttcagcaccccggccaatgcccctattggccattaccgcctcagcttggag
gcctccaccggctaccagggctccagtttcatgctggctcagttcaccctgctcttcaac
agctggtgtccagcggatgctgtgtacctgaactcagatgaggagcggcaagaatatgtc
cttacccagcaaggcttcatctaccagggctcagccaagttcatcaagagcataccttgg
aattttgggcagtttgaagacgggatcctagacatctgcctgatgctcctggacgtcaac
cccaagttcctgaagaatgccggccgagactgctcccgccgcagtagtccagtctatgtg
ggccgggtggtgagcggcatggtcaactgcaacgatgaccagggcgtgctgctggggcgc
tgggacaacaactacggggacggcatcagccccatgttctggatcggcagcgtggacatc
ctgcggcgttggaagaaagatggctgccagcgcgtcaagtatggccagtgctgggtgttt
gcagctgtggcctgcaccgtgctgcggtgccttggcatccccacccgcgtcgtgaccaac
tataactcagcccacgaccagaacagcaacctgctcatcgagtacttccgcaacgagtac
ggggagatccagagtgacaagagcgagatgatctggaacttccactgctgggtggagtcg
tggatgaccaggccagacctgcagccggggtacgaggggtggcaggccctcgaccccacg
ccccaggagaagagcgaagggacttactgctgtggcccggttcccgttcgtgccatcaaa
gagggtgacctgagcaccaaatatgatgcccctttcgtctttgccgaagtcaatgctgac
gtggtggactggatccggcaggacgatgggtctctgcacaaatccatcaaccactccctg
gtggtggggctgaagatcagcacgaagagtgtgggcagagatgatcgggaggacatcacc
cacaactacaagtacccggaggggtccccagaggagagggaagccttcacaagagccaac
cacctgaacaaactggttgataaagaggagacaggggtggccatgcggatccgtgtgggc
gagggcatgaacaggggctgcgacttcgacgtctttgcccacatcaccaacagcaccccc
gaggagcacactggccgcctcctgctctgtgcccgcaccgtcagctacaatgggatcctg
ggacctgagtgcggcaccaaggatctgctcagcctttccctggagccctactccgagaag
agcattccccttcgaatcctctacgaaaagtactgtgattgcctgaccgaatcgaacctt
atcaaggtgcggggccttctcattgagccggctgccaatagctacctgctggccgagagg
gacatctacctggagaatccagaaatcaagatccggatcctgggagagcccaagcagaac
cgcaagctggtggctgaggtgtctctgcggaacccgctcaccgaggcgctgtcgggctgc
accttcactgtggaggggtctggcctgatcgaggggcagaagacggtggatgccccggac
cccgtggaggcaggggaggaagtcaaagtgagggtggacctgctgccgctgtacgtgggc
cgccacaagctggtggtgaacttcgagagcgacaggctgaaggccgtgaagggcttcagg
aacgtcatcgttggccccgcctaa

DBGET integrated database retrieval system