KEGG   Capra hircus (goat): 102185682Help
Entry
102185682         CDS       T02910                                 

Gene name
CES5A
Definition
carboxylesterase 5A
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102185682 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 576 aa AA seqDB search
MSGEWVHPGQTLIWAVWVLAAATKGPATADAPARHTNLGWVRGTQASVLGNDMLVNVFLG
VPYAAPPVGPLRFAKPEPLLPWNGFLNATSYPKLCFQNSEWLFTDQHILKVRYPKFRVSE
DCLYLNIYAPAHAETGSKLPVMVWFPGGAFETGSASIFDGSALASYENVLVVTIQYRLGI
FGFFNTGDEHARGNWAFMDQVAALIWVQENIEFFGGDPRCVTIFGESAGAISVSSLILSP
MTKGLFHRAIMESGVAIIPYLKASDYERNDDLQTIASICDCNASDSVALLQCLRAKSSEE
LLSISQKTKSFTRVVDGLFFPSELLDLLAQKLFHLVPSIIGVNNHECGFLLPMKEFPEIL
GGSNKSLALQLIHSVLHIPVQYLYLVADEYFHNKHSLLDIRNRFLDLLGDVFFVVPGLVT
AQYHTDAGAPVYFYEFQHRPQCLKDRKPPFVKADHTDEIRFVFGGAFLKGNIVMFEEATE
EEKTLSRKMMRYWANFARTGNPNGNGLPLWPAYRESEEYLQLDLNISVGQRLKELELKFW
TETLPLMMTSAGALLAPLSSSAFLSLLPPFILSFAP
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagagtgggtgcacccaggccagaccctgatctgggctgtttgggtccttgca
gctgccaccaaggggccagccaccgctgatgcaccagccaggcacaccaacctgggatgg
gtccgggggacgcaagcttctgttctgggaaacgacatgctcgtaaatgtgttccttggg
gtcccttatgccgcaccccctgtagggcccctgcgatttgcaaaaccggagcctttactg
ccctggaatggtttcctaaatgccacgtcctaccctaaattgtgcttccagaactcagag
tggctgttcacagatcaacacattctcaaggtgcgttaccccaaattcagagtatcggaa
gactgcctgtaccttaacatctatgccccggcccatgcagaaaccggctccaagctcccg
gtcatggtgtggttccccggcggcgccttcgagactggctccgcatccatcttcgatggg
tccgccctggcttcctatgagaacgtgctggttgtgaccatccagtaccgactaggaata
tttggcttcttcaacacaggggacgagcacgcgcgggggaactgggccttcatggaccag
gtggccgctctgatctgggtccaggaaaacattgagttcttcggtggggacccacgctgc
gtgaccatcttcggcgagtcagcaggagcgataagtgtttccagccttattctgtccccc
atgaccaaaggcttattccacagagccatcatggagagtggggtggccatcatcccttac
ctgaaggcctctgattacgagaggaatgatgatttgcagacaattgcaagtatttgtgac
tgcaacgcatcagactccgtggccctgctgcagtgcctgcgggcaaagtcctccgaggag
ctgctgagcatcagccagaaaaccaagtctttcactcgagtggttgatggccttttcttt
cctagtgagctgctagacctgttggctcaaaaattgtttcatctggttccttccatcatc
ggagtcaataatcacgagtgtggcttcctgctacccatgaaggagtttcctgagatcctc
gggggctccaacaagtccctcgccctgcaactgatacactcagtcctgcacatccctgtc
cagtatttataccttgtggctgatgaatatttccacaacaagcactcgctgctcgatata
cgaaatcgcttcctggatttacttggagatgtgttctttgtggtccctgggctggtcaca
gctcaatatcacacagatgctggtgcccctgtctacttctatgagtttcagcatcggccc
cagtgcttgaaggacaggaagccaccttttgtcaaagctgatcacactgatgaaatccgc
ttcgtctttggaggtgccttcctgaagggcaacattgtcatgtttgaagaagccacagag
gaagagaaaacgctgagcaggaagatgatgagatactgggctaactttgctcggactggg
aatcctaatgggaacggtctgcctctgtggccggcctacagggagtctgaggaatacttg
cagctggacttgaacataagcgtgggacagagactgaaagagctggagctgaaattttgg
acagaaaccctccccttgatgatgacctcggccggagctctcctggctcctctttcgtcc
tcagccttcctttctctactcccgcctttcattctctcttttgctccctga

DBGET integrated database retrieval system