KEGG   Capra hircus (goat): 102186824Help
Entry
102186824         CDS       T02910                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase (Yt blood group)
  KO
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
chx  Capra hircus (goat)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102186824 (ACHE)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    102186824 (ACHE)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     102186824 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:chx00537]
 Enzymes
  102186824 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
25
AA seq 678 aa AA seqDB search
MPNPYPSRARPWPTAGEAAPSRHLKFPHRAPPVSEGPAPVGGLRPLVVVPPLGPRRSTGG
RRRLPALAAMRPPWCPLHTPSLASPLLLLLFLLGGGAEAEGPEDPELLVMVRGGRLRGLR
LMAPRGPVSAFLGIPFAEPPVGPRRFLPPEPKRPWPGVLNATAFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPSSPTPVPVWNSGASSLDVYDGRFLTQAEGTVLV
SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPASVTLFGESAGAA
SVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVGCPPGGAGGNDT
ELVACLRARPAQDLVDHEWRVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVL
VGVVKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQASDLAAEAVVLHYTDWLH
PEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLSWPLWMGVPH
GYEIEFIFGLPLEPSLNYTIEERTFAQRLMRYWANFARTGDPNDPRDPKAPQFPPLHVVT
CILRVLSELTLPPLQPPHVRSRSSLCPLPTHLPGTLAVDTLDEAERQWKAEFHRWSSYMV
HWKNQFDHYSKQDRCSDL
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacccatacccctccagggcccggccctggccaactgcaggagaggctgcgcct
tcacgccacctcaagttcccccatcgggcgcctcccgtcagtgagggccccgcccctgtc
ggtggcctgcggcctctagttgtggtgcctccgctgggcccaaggcgctccactggggga
aggagacgcctgcctgccctggcagccatgaggcccccgtggtgtcccctgcacacaccc
tccctggcttccccgctccttctcctcctcttccttctgggaggaggggcagaggccgag
ggcccagaggacccagagctcctggtgatggtgcgtgggggccggctgcggggcctccgc
ctaatggcccccaggggccctgtctctgcttttctgggcatccccttcgcagagccacct
gtgggcccccgtcgctttctgccaccggagcccaagcggccctggccaggggtgctgaat
gccacagccttccaaagcgtctgctaccagtatgtggacactctgtaccctggctttgag
ggcaccgagatgtggaaccccaaccgcgagctgagtgaggactgcctctacctcaacgtg
tggacaccgtacccccggccatcgtcccccacccccgtccccgtctggaacagcggggcc
tcctccctggacgtgtacgatggccgcttcctgacccaggccgaggggactgtgctggtg
tccatgaactaccgggtgggcgcctttggcttcttggcactgccagggagcagggaggcc
ccaggcaatgtggggctactggatcagaggctggcactgcagtgggtgcaggagaatgtg
gcagccttcgggggggacccagcgtcagtgactctgtttggggaaagtgcaggtgccgcc
tccgtgggcatgcacctgctgtccccacccagccggggcctgttccacagggctgtgctg
cagagtggggcacccaatgggccctgggccacagtgggcgtaggagaggcccgccgcagg
gccacactgctggcccgcctcgtgggctgtcccccgggtggggctggtggcaatgacaca
gagctggtggcctgcctgcgggcacggccagctcaggacctggtggaccatgagtggcgc
gtgctgcctcaggaaagcgtcttccgcttctccttcgtgcctgtggtggacggagacttc
ctcagtgacacacccgaggccctcatcaatgctggagacttccatggcctgcaggtgctg
gtgggtgtggtgaaggatgagggctcctattttctggtttatggggccccaggcttcagc
aaagacaacgagtctctcatcagccgggcccagttcctggccggggtgcgggtcggggtc
ccccaggcaagtgacctggctgccgaggctgtggtcctgcattacacagactggctgcac
cctgaggacccagcacgcctgagggaggctttgagtgatgtggtgggcgaccacaacgtc
gtgtgccccgtggcccagctggctgggcgactggccgctcagggcgctcgcgtctatgcc
tacatctttgaacaccgtgcatccacgctctcctggcccctctggatgggggtcccccat
ggctacgagatcgagttcatcttcgggctccccctggaaccctcgctcaactacaccatc
gaggagagaacctttgcccagcgactgatgagatactgggccaacttcgcccgcacagga
gaccccaatgacccccgggaccccaaagccccacagtttccaccacttcacgtggtcacc
tgcattctccgtgtcctctctgaactcacgctaccccctctccaacccccgcatgtccgt
tcccgttcttccctatgtcctctccccacccacttgccgggcactctggccgtagacacg
ctggacgaggcggagcgccagtggaaggccgagttccatcgctggagctcctacatggtg
cactggaagaaccagtttgaccattacagcaagcaggatcgctgctcagacctgtga

DBGET integrated database retrieval system