KEGG   Capra hircus (goat): 102187330Help
Entry
102187330         CDS       T02910                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102187330 (NCOA3)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102187330 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 1409 aa AA seqDB search
MSGLGENALDQLAPDSRKRKLPCDPPGQGLACSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNREGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEDDRKDFLKNLPKSTVN
GVTWTNETQRQKSHTFNCRMLMKIPHDILEDINTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRIATGERAFPSSPESFITRHDLSGKVITIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPLYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPNPVGQGIRPPAAGCNSSVGGMSMSPNPGLPMLSSRTYGV
TDPGTAGQMSGARYGASGSIGSMNPGPGMQSPSSYQNSTYGLNMSSPPHGSPGLSSSQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNAVSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNITQPSKVNSQDSKSPIGLYCDQNPVESSMCQSNSRDHINDKESK
ESSVEGSENQRAPLESKGHKKLLQLLTCSSDDRGHASLTNSPLDSGCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSCVEG
NVKQEQLSPKKKESNALLRYLLDRDDPSDTLAKELQPKVEGVDSKMSQCSSSTIPSSSQE
KDAKIKTETNEEGSGDLDNLDAILGDLTNSDFYNNSISTSGSNLGTKPQMFQGANSLGLR
SPQSVQSLRPPYNRAVSLDSPVSVGSSPPVKNIGAFPMLAKQPMLGGNPRMMDNQENYGS
NMGGPNRNVTVNQAPSSGDWGLPSSKASRMEPVNSNAMGRPGTDYNAPLPRPAMGGSMPA
MPLRSNSVPGSRPVTQQQQQQPPQMLQMRPGEIPMGMGVSPYGQAAPSNQPGSWPDGMLS
MEQGPHGTQNRPILRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRAL
GIPELVNQGQALEPKQDAFPGQEAAVMMEQKAALYGQTYPGQGPPMQGSFNLQGQSPPFN
SMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKME
NPTAGGAAVMRPMMQPQVNSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQ
QPQAFSPPPNVTASPSMDGVLAGPAMPQAPPQQFPYPPNYGMGQQPDPAFGRVPSPPNAM
MSSRMVPSQNPMIQHPQTAPMYQSSEMKGWPSGTLARSSTFPQQQFAHQGNPAAYSMVHV
NGSSGPMGQMNMNAMPMAGMPMGPDQKYC
NT seq 4230 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggttaggagaaaacgctttggatcaactggcccctgattcacgaaaacgcaag
ttgccatgtgatcctccagggcaaggccttgcctgcagtggtgaaaagtggagacgggag
caggagagtaaatatattgaagaattggctgaactaatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcgattttaaaagaaacagtaagacagata
cgtcaaataaaagagcaaggaaaagctatttccagtgatgatgatgttcagaaagctgat
gtatcttccacaggacaaggagttattgataaagactccttaggaccactcttacttcag
gcattggacggcttcctatttgtggtgaatcgtgaaggaaacattgtatttgtgtcagaa
aatgtcacccagtacctgcaatataagcaagaggacctggttaatacaagtgtctacaat
atattgcatgaagacgatagaaaggattttcttaaaaacttaccaaaatctacagttaat
ggagttacctggacaaatgagacccagagacaaaaaagccatacatttaactgccgtatg
ttgatgaaaataccgcatgacattctggaagacataaacaccagtcctgaaatgcgccag
agatacgagacgatgcagtgctttgccctgtcccagccgcgggctatgatggaggaaggc
gaagacttgcagtcctgtatgatctgtgtggcacgccgcattgccactggagaaagagca
tttccatcaagtcctgagagctttatcactagacacgatctttcagggaaagttattact
atagacaccaattcactgagatcctccatgagacctggctttgaagacataatccgaagg
tgtatccagagattttttagtcttaatgatgggcagtcatggtcccagaaacgtcactat
caagaagcttatatccatggccatgcagaaaccccactgtatcgattctctttggctgat
ggcactatagtgactgcacaaacaaaaagcaaactcttccgaaatcctgtaacaaatgac
cgtcatggctttgtctcaacccactttcttcagagggaacagaatgggtatagaccaaac
ccgaatcctgttggacaaggcattaggcctccagcagctggatgcaacagttcagtaggc
ggcatgagtatgtcaccaaacccaggcttaccgatgctgagcagcaggacttatggtgta
actgatcctggcactgcggggcagatgagtggagccaggtatggggcttccggtagcata
ggctctatgaaccctgggccaggcatgcagtcaccatcttcctaccagaacagtacctac
ggtctcaacatgagtagccctccacacgggagccctggtctcagctccagccagcagaat
atcatgatttctcctcgtaatcgagggagtccaaagatggcctcacaccagttttctcct
gtcgcaggtgtgcactctcccatgggatcttctggcaatgccgtgagtcacagcttttct
agcagctctctgagtgcccttcaagctatcagtgagggcgtggggacttctcttttatct
acactgtcttcgccaggtcccaaattggataattctcccaatatgaatataactcaacca
agtaaagtgaacagtcaggattccaagagtcccataggcttgtattgtgaccagaatcca
gtggagagttcaatgtgtcagtcaaatagcagagatcacattaacgacaaagaaagtaag
gagagcagtgtggaagggtctgagaatcagcgggctcctctggaaagcaaaggtcacaaa
aagttgctgcagttactcacttgttcttctgatgaccggggtcatgcctccttgaccaac
tcccccctggactcaggttgtaaggactcttccattagtgtcaccagcccctctggcgtc
tcctcttccacctccggaggtgtatcctccacatccaacatgcacgggtcgctgctgcaa
gagaagcaccggattttgcacaagttgctccagaatggaaattcaccagcagaagtagcc
aagattaccgccgaagccactgggaaagacactagcagtacgacgtcttgtgtagaagga
aacgtcaagcaggagcaactcagtcctaagaaaaaggaaagtaacgctctgcttaggtat
ctgctggacagggacgatcctagtgacacactcgccaaagagctccagcccaaagtggaa
ggtgtggacagtaaaatgagtcagtgcagcagctccaccattccgagctcgagtcaagag
aaagatgctaaaattaagacagaaacaaatgaagagggatccggagacttggataatcta
gatgctattcttggtgatctgactaattctgacttctacaataattccatatccacaagt
ggtagtaacctgggaactaagccacaaatgtttcaaggagctaattctctgggtttgagg
agtccgcagtctgtgcagtctctccgtcctccgtataaccgggcagtgtctctagacagt
cctgtttccgttggctcaagtcctccagtaaagaatattggtgctttccccatgttagca
aagcaacccatgctgggcggcaatccaagaatgatggataatcaggaaaattatggctca
aatatgggtgggccaaacagaaatgtgactgtgaatcaggcgccttcctcaggagactgg
ggcttaccgagctccaaggccagccgcatggaacccgtgaattcaaatgccatggggaga
ccaggaactgattataacgctcctttacccagacctgccatgggcggctcgatgcccgcc
atgccacttcggtccaatagcgtcccaggttcgagaccagtgacgcagcagcagcagcag
cagccgccacagatgcttcagatgcggcctggtgagattcccatggggatgggggtcagt
ccttatggccaagcagcaccatcaaaccaacctggttcctggccagatggcatgttgtcc
atggaacaaggccctcatgggacccaaaataggccaattcttaggaattccctggatgat
ctccttgggccaccttctaacctagaaggccagagtgatgaaagagcattgttggaccag
ttgcacacactcttgagcaacacagatgccacaggcctggaagagattgacagagctctg
ggcattcctgagcttgtaaatcagggacaagcgttggagcccaaacaggatgctttcccc
ggccaagaagcagcagtaatgatggagcagaaggcagcattatatgggcagacgtacccg
gggcaggggcctccgatgcaaggaagctttaatcttcagggacaatcaccaccttttaac
tcgatgatgaatcagatgaaccaacaaggcaattttcctctccaaggaatgcaccctcgg
gccaacatcatgagaccccgaacaaacactcccaagcaacttagaatgcagcttcagcag
aggctgcagggccagcagtttttgaatcagagccgtcaggcacttgaaatgaaaatggaa
aaccccactgctggcggggcggcggtgatgaggcccatgatgcagccgcaggtcaactcc
cagcagggtttccttaatgctcagatggtcgcccagcgcagcagagagctgctgagccat
cacttccggcagcagagggtggcgatgatgatgcaacagcagcagcagcagcagcagcag
cagccccaggccttcagtccacccccgaacgtgactgcgtcccctagcatggacggggtc
ctggctgggcctgccatgccgcaagctccaccccagcagtttccatacccaccaaattat
gggatgggacaacaaccagatccagcctttggtcgagtgcctagtcctcctaatgcgatg
atgtcatcaagaatggttccttcccagaatcccatgatccagcatcctcagaccgcaccc
atgtatcagtcttcagaaatgaagggctggccgtcaggaaccctggccaggagcagcacc
tttccccagcagcagtttgcccaccaggggaatcctgcagcgtacagcatggtgcacgtg
aacggcagcagtggtcccatggggcagatgaacatgaatgccatgcccatggctggcatg
cccatgggtcctgatcagaaatattgctga

DBGET integrated database retrieval system