KEGG   Capra hircus (goat): 102188887Help
Entry
102188887         CDS       T02910                                 

Definition
liver carboxylesterase-like
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
chx  Capra hircus (goat)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102188887
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102188887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 566 aa AA seqDB search
MWLFALVLTSISTLTAWAGLPPSSPVVDTAQGRVLGKHVSLKGFAQPVAVFLGIPFAKPP
LGSLRFAPPQPAEPWTFVKNTTSYPPMCSQNAMFGEMASDLLSNGMESVKPKFSEDCLYL
NIYTPADLTKRSRLPVMVWIHGGGLMVGGASTFEGLALSAHENVVVVTIQYRLGIWGFFS
TGDEHCRGNWGLLDQVAALLWVQENIANFGGDPGSVTIFGESAGGESVSVLVLSPLARNL
FHRAISESGVALTSALVKRDSEAAAEQIAVFAGCKTITSAVLVHCLRQKTEDELLEVTQK
MNFFKLDLYGDPREIYPFLPTVVDGVVLPKTPEEMLAEKNFNTVPYIVGVNKQEFGWLLP
LLVRYPLSEVKLYQKTATSLVWQYYPILNIPEQLAPVATDKYLGGTDDPVKKKGLFLDLI
GDVMFGVPSVNVARHHRDAGAPTYMYEFHYRPSFLAELKPKTVIGDHGDELFSVFGAPFL
KDGASEEEINLSKMVMKYWANFARNGNPNGEGLPHWPVYDHREGYVQIGVNTRGAEKLKN
KEVAFWNELLSGEAAKKAPHLTHVEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttcgcgctggttctaacctccatctctactttgacagcttgggcagggctg
ccgccctcatcgcctgtcgtggacaccgctcagggcagagtcctggggaaacatgtcagc
ttaaaaggatttgctcagcctgtggccgtcttcctgggaattccttttgccaagcctcct
cttggatccttgaggtttgctccgccgcagcctgcagaaccatggacctttgtgaagaat
accacctcttaccctcccatgtgctcccaaaacgcaatgtttggggaaatggcctcagac
ctccttagcaatggaatggagagcgttaagcctaaattttctgaagactgtctttaccta
aacatatacacccctgctgacttgacgaagagaagcaggctgccggtgatggtgtggatc
catggaggaggtctcatggtgggcggggcatcaacctttgaagggctggccctctctgcc
catgaaaatgtggtggtggtgaccattcagtaccgcctgggcatctggggcttcttcagc
acaggggacgagcactgccgggggaactggggcctcttggatcaggtggccgcgctgctc
tgggtccaggagaacattgccaactttggcggggatccaggctctgtgaccatctttgga
gagtcagcaggaggggaaagtgtgtctgttcttgtgttgtcccccctggccaggaatctc
ttccaccgggccatctctgagagcggcgtggccctcacttccgccctggtcaagagggac
tcggaggctgcagctgagcaaattgctgtctttgctgggtgcaagaccatcacctcggct
gtccttgttcactgcctgcgccagaagacggaggatgagctcttggaggtaacacagaag
atgaactttttcaaacttgatttatatggagaccctagagagatctaccctttcctgccc
accgtggttgacggagtggtgctgccaaagacgccagaggagatgctggctgaaaagaac
ttcaacactgttccctacatcgtcggagtcaacaagcaggagtttggctggcttctgcca
ttgctcgtgagatatccactctctgaagtcaagctgtaccagaagacggccacatcactc
gtgtggcagtactaccccatcctgaacattcctgagcaactggctccagtggccacggac
aagtatttaggagggacagacgaccctgtcaaaaagaaaggcctgttcctggacttgata
ggagatgtgatgttcggtgttccgtctgtgaacgtggcccgtcaccacagagatgctgga
gccccaacctacatgtatgagtttcattatcgcccaagcttcttagcagagctgaaacca
aagacggtgataggagaccacggggatgagctcttctctgtcttcggggctccatttctg
aaagatggtgcatcagaagaggagatcaatctcagcaagatggtgatgaaatactgggct
aactttgctcggaatgggaaccccaatggggaggggcttccccattggccggtatatgat
catagagaagggtacgttcagattggtgtcaacactcggggagccgagaagctgaaaaac
aaggaagtggctttctggaatgagctactgtccggggaggcggcaaagaaggcaccacac
ttaacacatgttgagctgtga

DBGET integrated database retrieval system