KEGG   Capra hircus (goat): 102188907Help
Entry
102188907         CDS       T02910                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
chx  Capra hircus (goat)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102188907 (GLS)
   00220 Arginine biosynthesis
    102188907 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    102188907 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102188907 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    102188907 (GLS)
   04727 GABAergic synapse
    102188907 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102188907 (GLS)
   05206 MicroRNAs in cancer
    102188907 (GLS)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     102188907 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 673 aa AA seqDB search
MMRLRGSAMLRDLFLRPPAAGCAVLMRAQPLVTLCRRPLGGGRTGQVAAARLYPWWGGGG
RSAGPLARGLSSSPSEILQELGKGGTQQQQQPPPQPGASPPAVPQAPGPKDGPGETDAFS
NNEGKELVPSGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLK
ECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYE
SAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSVGDTKVPFCLQSCVKPLKYAIA
VNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFD
YVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQ
LCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHV
GLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHF
AKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAE
GHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGK
ENQTVHKNLDGLL
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgactccgaggctcggcgatgctgcgggacctgttcttgcgcccgcccgctgcc
ggctgcgcggttctgatgcgggcgcagcccctcgtcaccctgtgccggcgacccctgggc
gggggacgaacgggccaggtggccgccgcgcggctctacccgtggtggggcggaggcggt
cggtcggcggggcccctcgcgaggggcctgtccagctcgccctcggagatcctacaggag
ctgggcaaggggggcactcagcagcagcagcagccgccgccgcagcctggggcgtcgccg
cccgcagtcccgcaggcgcccggccccaaggacggcccgggggagacggacgcgttctcc
aacaacgagggcaaggagctggtgccttcaggcgaaaataaaataaaacagggtctgtta
cctagtttggaagatttgctgttctatacaattgcagaaggacaagagaaaatacctgtt
cataaatttattacagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaa
gagtgtatggatatgttaagattaactcttcaaacaacatcagatggtgtcatgctagac
aaagatctttttaaaaaatgtgttcaaagcaacattgttttgttgacacaagcctttaga
agaaaatttgtcattcctgactttatgtcttttacttcacatatcgatgaattatatgag
agtgctaaaaagcagtctggaggaaaggttgcagattatattcctcaactagccaagttc
agccctgatttgtggggtgtatccgtttgtacagtagatggacagaggcattctgttgga
gataccaaagttccattttgtcttcagtcctgtgtaaaacctttgaaatatgccattgct
gttaatgaccttggaacagaatatgtgcatcgatatgttgggaaagagccaagtggatta
aggttcaacaaactgtttttaaatgaagatgataaaccacacaatcctatggtaaatgct
ggagcaattgttgtgacttcattaataaagcaaggagtgaataatgctgaaaaatttgac
tatgtaatgcagtttttgaataagatggctggtaatgaatatgttggattcagtaatgca
acgtttcagtctgaaagagaaagtggagatcgaaattttgcaataggatattacttaaag
gaaaaaaagtgtttcccagaaggcacagacatggttggtatattggacttctatttccag
ctatgctccattgaagtaacttgtgagtcagctagtgtgatggcagcaacactggctaat
ggtggcttctgcccaatcactggtgaaagagtactgagtcctgaagcagttcgaaataca
ctcagtttgatgcattcctgtggcatgtatgatttctcagggcagtttgctttccatgtt
ggtcttcctgcaaaatctggagttgctggtggcattcttttagttgtccccaatgtcatg
ggcatgatgtgctggtctcctcctctggacaagatgggcaacagtgttaagggaattcac
ttctgtcatgatcttgtttctctgtgtaatttccataactatgataatttgagacacttt
gctaaaaaacttgatcctcgaagagaaggtggtgatcagagggtaaagtcagtgataaac
cttttgtttgctgcatatactggagatgtgtctgcacttcgaaggtttgctttgtcagcc
atggacatggaacagcgagactatgattctagaacggcactccacgtagctgctgcagag
ggtcatgttgaagttgttaaatttctgctggaagcctgcaaagtaaatcctttccccaag
gacaggtggaataacactcccatggacgaagcactgcactttgggcaccatgacgtattt
aaaatcctgcaggaataccaagtccagtacacgcctcaaggagattccgacaacggaaag
gagaatcaaacggtccataagaatctcgatggactgttataa

DBGET integrated database retrieval system