KEGG   Capra hircus (goat): 102188970Help
Entry
102188970         CDS       T02910                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle-like
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
chx  Capra hircus (goat)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102188970
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102188970
   04152 AMPK signaling pathway
    102188970
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102188970
   04922 Glucagon signaling pathway
    102188970
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102188970
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102188970
Glycosyltransferases [BR:chx01003]
 Polysaccharide
  Storage polysaccharide
   102188970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 604 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRV
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctccctgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcggcatctacacagtgctgcagacgaaggcaaaggtgacgggggatgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctg
gaacccccgacgccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtacttcgggcgctggctgatcgaggggggccccctggtggtgctcctcgatgtgggg
gcctcagcctgggccctggagcgctggaagggggagctatgggacacatgcaacatcggg
gtgccctggtacgaccgggaggccaacgacgccgtccttttcggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagtgaggagaaaccacatgtggttgcacacttccac
gagtggctagcaggcgtcgggctctgcctgtgccgcgcccggcggctgcccgtggctacc
atcttcaccacccacgccacgctgctggggcgatacctgtgtgccggggccgtggacttc
tacaacaacctggagaatttcaacgtggacaaagaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggccgcagcccactgtgctcacgtcttcactactgtgtcccag
attaccgccatcgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctagacttcaacttg
gacaagaccttgtacttctttattgccggccgctatgagttctccaacaagggggccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagcgagcag
acggtggttgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctt
aagggccaggccgtgcgcaagcagctttgggatacagccaacacagtgaaggaaaagttt
gggaggaagctttacgaatccttgctggtgggaagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccacgcagcggcaatctttc
cctcctgtgtgcacccacaatatgctggatgactcctcagaccccatcttgacaaccatc
cgccgaatcggcctcttcaatagtagtgctgacagagtcaaggtgattttccacccggag
ttcctgtcctctacgagccctctgctccctgtggactatgaggaatttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacaccagctgagtgcacg
gtaatgggtatccccagtgtctccaccaacctctccggattcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctggaccggcgattccgcagcttg
gatgattcctgctcgcagctcacctccttcctctacagtttctgccagcagagccgaagg
cagcgcattatccagcggaaccgaacggagcgcctctctgatcttctggactggaaatac
ctaggccgggtataa

DBGET integrated database retrieval system