KEGG   Capra hircus (goat): 102188970Help
Entry
102188970         CDS       T02910                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1 (muscle)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
chx  Capra hircus (goat)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102188970 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102188970 (GYS1)
   04152 AMPK signaling pathway
    102188970 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102188970 (GYS1)
   04922 Glucagon signaling pathway
    102188970 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102188970 (GYS1)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102188970 (GYS1)
Glycosyltransferases [BR:chx01003]
 Polysaccharide
  Storage polysaccharide
   102188970 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
18
AA seq 736 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEYFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDLPPDEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGSKRGSVDTAPSSSVST
PSEPLSPASSLGEERN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctccctgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcggcatctacacagtgctgcagacgaaggcaaaggtgacgggggatgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctg
gaacccccgacgccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtacttcgggcgctggctgatcgaggggggccccctggtggtgctcctcgatgtgggg
gcctcagcctgggccctggagcgctggaagggggagctatgggacacatgcaacatcggg
gtgccctggtacgaccgggaggccaacgacgccgtccttttcggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagtgaggagaaaccacatgtggttgcacacttccac
gagtggctagcaggcgtcgggctctgcctgtgccgcgcccggcggctgcccgtggctacc
atcttcaccacccacgccacgctgctggggcgatacctgtgtgccggggccgtggacttc
tacaacaacctggagaatttcaacgtggacaaagaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggccgcagcccactgtgctcacgtcttcactactgtgtcccag
attaccgccatcgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctagacttcaacttg
gacaagaccttgtacttctttattgccggccgctatgagttctccaacaagggggccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagcgagcag
acggtggttgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctt
aagggccaggccgtgcgcaagcagctttgggatacagccaacacagtgaaggaaaagttt
gggaggaagctttacgaatccttgctggtgggaagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccacgcagcggcaatctttc
cctcctgtgtgcacccacaatatgctggatgactcctcagaccccatcttgacaaccatc
cgccgaatcggcctcttcaatagtagtgctgacagagtcaaggtgattttccacccggag
ttcctgtcctctacgagccctctgctccctgtggactatgaggaatttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacaccagctgagtgcacg
gtaatgggtatccccagtgtctccaccaacctctccggattcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctggaccggcgattccgcagcttg
gatgattcctgctcgcagctcacctccttcctctacagtttctgccagcagagccgaagg
cagcgcattatccagcggaaccgaacggagcgcctctctgatcttctggactggaaatac
ctaggccggtactacatgtcagcgcgccacatggcgctggccaaggcctttccagaatac
ttcacctacgagcctcacgaggctgacgcgacccagggctaccgctacccacggccagcc
tcagtgccaccatcaccctcgctgtcgcgacactccagcccgcaccagagcgaggatgag
gaggaaccccgggacttaccaccggatgaagatggcgaacgctacgacgaggacgaggag
gccgccaaggaccggcgcaatatccgcgcgcccgagtggccgcgccgcgcctcctgcacc
tcttccaccgggagcaagcgcgggtcggtggacacggcgccctccagctcagtcagcacc
cccagcgaaccccttagccccgccagctccctgggcgaggaacgcaactaa

DBGET integrated database retrieval system