KEGG   Capra hircus (goat): 102189931Help
Entry
102189931         CDS       T02910                                 

Gene name
ALDH1L2
Definition
(RefSeq) aldehyde dehydrogenase 1 family member L2
  KO
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
chx  Capra hircus (goat)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    102189931 (ALDH1L2)
Enzymes [BR:chx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     102189931 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
5
AA seq 923 aa AA seqDB search
MLWRGGQALRRFSTSRICFKNKLKVALIGQSLFGQEVYSHLCKEGHRVVGVFTVPDKDGK
ADPLALAAEKNGTPVFKFPRWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDVIDGP
KHGSIVYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDVLYNRFLFPEGIKAMVEAVQLIADGKAPRIPQSEEGATYEGIQKKENAEISWNQSAE
ALHNWIRGHDKVPGAWAEINGQVVTFYGSSLLNSSVPPGEPLEIKGAEKPGLVTKNGLVL
FGNDGKALLVRNLQFEDGKMIPASQYFSSGEMPVVELTAEEVKVAETIKVIWAGILSNVP
AIEASTDFFKSGARSMDVARLVEEIRQKCGGLQLQNEDVYLATKFEDFIQKVVRKLRGED
QEAELVVDYVSKEINDMTVKMPYQCFINGQFTDAEDGKTYDTINPTDGSTICQVSYASLV
DVDKAVAAAKDAFENGEWGRMNARDRGRLMYRLADLMEEKQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNSLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGVVGQRLSE
HPDIRKLGFTGSTLIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLL
QYCEAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFPNGD
IDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGFKQSG
FGKDLGEEALNEYLKTKSVTLEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgttgtggcggggcggccaggcgctccggcgcttctccaccagccgaatttgtttcaaa
aacaagctgaaagtggcacttattggtcagagcctctttggacaggaggtctatagtcat
ctctgcaaagaaggccaccgagtcgtgggagtgttcacagttccagacaaagatggaaaa
gctgacccacttgcattggctgcagagaaaaatgggacccctgtgttcaagttccctaga
tggagagtcaagggcaagaccataaaggaggtggcagaggcctacagatccgtgggtgct
gagctcaacgtacttcccttctgcacacaattcatccccatggacgtaattgatggccca
aagcatggttccatcgtttatcacccgtctatccttcccaggcacagaggagcttctgct
atcaactggactctaatcatgggagataagaaagctgggttttctgttttctgggctgat
gatggtttagacacaggacccatccttctccagaggtcgtgtgatgtggagcccaatgat
accgtagatgtgctttataatcgatttctttttccagaaggaatcaaggccatggtggaa
gctgtccaacttatagctgatggtaaagctcctcgcattccccagtcagaagaaggagca
acatatgaaggtatccagaaaaaggaaaatgctgagatctcttggaatcagtctgctgaa
gctttacataactggatccgaggtcatgataaagtccctggagcttgggcagagataaat
ggacaggtggtcactttctatggctcatcattgctgaatagctccgtccctcctggagaa
ccactggaaattaaaggtgctgagaagcctggtcttgttaccaaaaatggacttgttctt
tttggtaacgatggaaaagcactgctggtgagaaatctgcagtttgaagatggaaaaatg
attcctgcctctcagtacttttcatcgggtgagatgccagtggtggaactcacagctgaa
gaggtgaaggtggcagagaccatcaaggtcatctgggctggaattttaagcaatgtccct
gctattgaagcttcaacagacttctttaaatctggagcaagatcaatggatgttgccaga
ctggttgaagagataagacagaagtgtggagggcttcagttacagaatgaggatgtttat
ctggccaccaaatttgaagacttcatccaaaaagtcgtgaggaaactgagaggagaggat
caggaagcagagctagtggtggattatgtttcaaaggagatcaatgacatgacagtaaaa
atgccatatcagtgtttcataaatggacagttcacagatgctgaagatggaaagacttat
gatactatcaacccaacagatggatctacaatatgccaagtatcctatgcctctttggtg
gatgttgataaagcagtagcagcagcaaaagatgcctttgaaaacggtgaatggggaagg
atgaatgcacgagacagaggaagactgatgtatcgacttgcagacctaatggaagagaaa
caagaagaactggcaaccatcgaagctctcgattctggggctgtctacaccttggctctg
aagactcacattggaatgtctgtgcagacattcagatattttgctggctggtgtgacaaa
attcagggttccacaattcccatcaaccaggcccgtccaaatcgcaatctgacctttacc
aagaaggagcctcttggagtctgtgcaattatcatcccttggaattacccgctgatgatg
ctggcatggaagagtgccgcgtgtctggcagcaggcaacagcttagtgctcaagccagca
caggtcacgcccttgactgctttgaagtttgctgagctctctgttaaagcaggctttccg
aagggggtaatcaacatcattccaggctcaggcggtgtagtgggacagcgcctttcagag
caccctgatatccgcaaacttggtttcactggctccactctgattggcaagcagatcatg
aagagctgtgctgtgagcaacttgaagaaagtttcccttgaacttggtggaaaatcccca
cttataatattcaatgactgtgaacttgacaaggctgtgcgaatgggcatgggggcagta
tttttcaacaaaggagaaaactgtattgcagctggtcggctgtttgtggaagaatccatc
cacgatgaatttgtgacaagagtggtggaagaaattaaaaagatgaaaattggtgatcca
cttgacagatctaccgaccatgggccccaaaatcataaggcccatctggaaaagcttctg
cagtactgtgaagctggagtgaaagagggggccaccctggtgtacggaggaagacaagtc
caaaggccaggcttttttatggaacctactgtcttcacagatgtggaagaccacatgtat
cttgccaaagaggaatcctttgggcctatcatggtcatttctaaattcccaaatggggac
atcgatggagtgttgcagcgagcaaataatacagaatacggcttggcctcaggagttttt
acaagagacataaataaagccatgtatgtgagtgaaaaactagaagcaggaactgttttt
attaacacctacaacaagacggatgtggctgctcctttcggtggatttaagcagtctgga
tttggaaaagacttaggcgaggaagctctaaacgagtacctcaaaaccaagtctgtgacg
ctggaatactag

DBGET integrated database retrieval system