KEGG   Capra hircus (goat): 102190166Help
Entry
102190166         CDS       T02910                                 

Definition
lysozyme-like protein 6-like
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102190166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 148 aa AA seqDB search
MTSPLLISLVSCLVAVDQASLIGRCDLAKVLHQEDLDGFEGYSLTDWLCLAFVESDFNIT
KVNENTDGSFDYGIFQINSHYWCNDYQSHTENNCQVDCQELLSPNLLAIINCAKKIVSGA
GGMKNWVKWRLHCAGRPLSYWMTGCHLA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcccactgctcatctccttggtcagctgcctcgttgctgtggatcaagccagc
ctcatcggccgctgtgacttggccaaggtgctgcaccaggaggacttggatgggtttgag
ggctactccctgactgactggctgtgcctggctttcgtagagagtgatttcaacataaca
aaggtaaatgaaaacacagatggcagctttgactatggcatcttccagatcaacagccac
tactggtgcaacgattaccagagtcacacggaaaacaactgccaagtggactgtcaagaa
ctgctgagccccaatcttctcgcaattatcaactgtgcaaaaaagattgtgtccggagcg
ggggggatgaagaactgggtaaagtggaggttgcactgtgccggccggcccctctcctac
tggatgacaggctgtcacctggcatga

DBGET integrated database retrieval system