KEGG   Capra hircus (goat): 102190662Help
Entry
102190662         CDS       T02910                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102190662 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
28
AA seq 2054 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTTNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGGLD
GKGAPKYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
PGTTQKLKPPLSSLPPPTPISGQSPSSQKSSTSVSSTSPQSSSSQSSVPSFSSLTNNSQL
KALFDGLSHIYTTQGQSRQKGHPSYAPPKRMRRKTEFPLTAKSKAHFFGKRDIRSRFISH
SSSSSWGMARGRIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKISIKQESTDINVIGNKDTVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILGHMEKLKTCSRTNELDPESLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSSRANSRQSPAKVQSKNKYLHSPESRPVAGERGQLMELSKESSEEEEEEEEEEE
EEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVVKKKRGRKRRRINSSVT
TETISETTEVLNEPFDNSDEERPMPQLEPTCETEVEEDSRKPVPRRAFQHQPGKKRQTEE
EEGEDNHCFKSTDPCRNNVDDGANNLKEASRDNPEPLKCKQWPKGTKRALSKWRPNKERK
TGFKLNLYTPPETPLEPDDQVTAEEQKETPADKTSPTSTRIEEGVKEAVEPLLPQDENGR
EETCAPISPNKSPGGKPEDELIKPEEEEEEEEEEEEERNVEKDDPSGAKSQDKEEPEVCM
DKEDPVHLDDHEEEEEEEEEPSHNEGHDADDEDDSHMASAEVKEEHPREAFKEVLENQGA
FLDLSAPPSHSNPEVLMDCGVDLPASCNSEPKELAGATETAPESDEEPPGEQAQKQDQKN
SEEADSEFKEGNTATLEIDSETVQAVQSLTQENSEQDDTFQDCAETQEACRSLQNYTHAD
QSPQISAALDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVPALENSYAQISPDQSAISVP
SLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNGS
SQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSISSPPTCSVKSPQGCVVERP
PSSSQQLAQCSMAANFTPPMQLAEIPETGSANLGLYERMGQSDFGAGHYPQPSATFSLAK
LQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMT
PPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHVSMRTKSASLSPAAATH
QSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPSPAYNVNSVNMNMNTLNAMNGYSMSQ
PMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHGNMMYTAPGHHGYMNT
GMSKQSLNGSYMRR
NT seq 6165 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aagaagcaaaagcaaaggccctccgaagagagaatctgccatgccgtcagcacttcccat
gggttggataagaagaccgtctctgagcagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctacaaggacccagacaatcctgggcgcttc
tcatcagttaaaccaggcactttccctaagtcagccaaggggtcgagaggatcatgcaat
gatctgcgtaacgtggattggaataaacttctaaggagagcaattgaaggactggaggag
ccaaatggctcctccctgaagaacattgagaagtatctcagaagtcaaagtgatctcaca
agcaccaccaccaacccagcctttcagcagcggctgcgactgggggccaaacgcgcggtg
aacaatgggaggttactgaaagacggaccgcagtacagggtcaattacggaggcttagat
ggcaaaggggctcccaagtaccccagtgctttcccatcttcactcccacctgtcagcctt
ctaccccacgagaaagatcagccccgtgccgatcccattccaatatgtagcttctgtctg
gggacaaaggaatcaaatcgtgaaaagaaaccagaagaacttctctcttgtgcagattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattaacaacaaacgtaaag
gccttaaggtggcagtgcatcgaatgcaagacgtgcagtgcgtgtagaatccaaggcaaa
aatgcagataatatgcttttctgtgactcctgtgatagaggattccatatggagtgctgt
gatcccccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatccggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
ccaggtaccacacaaaagctaaaacctccactttcttcactcccacccccgactcccatc
tctggtcagagccccagctcacaaaagtccagcacttctgtttcttctacctctccccag
agttcttccagccagtccagcgtgccctcctttagcagtcttactaataacagccagctg
aaggcactctttgacggactctctcatatctataccactcagggacagtctcgccaaaag
ggacacccaagttatgcaccacctaaacgtatgcgtcgtaaaaccgaattccctctcaca
gcaaaatctaaagcccatttctttggaaaaagagatattagaagtaggtttatttctcac
tcctcctcctctagctgggggatggctagagggcgtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcaggttaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatacggaaatcaaaataagcatcaaacaggaaagtacagatataaat
gtgattggaaacaaggataccgttactgaagaggatttggatgttttcaagcaggcccag
gaactgtcttgggagaaaatagagtgtgaaagtggagtggaagactgtggccggtaccct
tctgtaatagaatttgggaaatatgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttattaagacactcaaagaaatgtggatggtttcatcctccagcaaatgaa
atttaccgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacattgtattatgat
gtcgagccattccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaaactttgccagcagaagtataacgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctcgaagagagggccaagcagggtctcctgaaaagccactctccgatctaggtcgtctc
tcctacctggcctactggaagagtgtcatcttagaatatctctaccaccaccacgagcgg
cacatcagcatcaaggccatcagcagagccacgggcatgtgcccccatgacatcgccacc
actctgcagcacctccacatgatcgacaagagagatggccgatttgtcatcattagacgg
gaaaagttgatattgggccacatggaaaagttgaaaacctgttcccggaccaatgaactt
gatccagagagtctgaggtggaccccaatcttaatttctaatgctgcagtttctgaagaa
gaacgagaagccgaaaaagaggccgagcggctaatggaacaagctagctgctgggaaaaa
gaggagcaagaaatcctgtcatctagagctaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtggcaggggagcgagggcag
ctgatggagctgtctaaagagagcagtgaagaagaggaggaggaagaagaggaggaagag
gaagaagaggaagaggaagaggaggaggaggaggaggaagaagaggaagaggaagaaaat
atccaaagctctcctccaagattgactaaaccacagtcagttgccataaagagaaagagg
ccttttgtagtaaagaagaaaaggggtcgtaaacgcaggaggatcaacagcagtgtaaca
actgagaccatttctgagacaacagaagtactgaatgagccctttgacaactcagacgaa
gagaggccaatgccacagctggagcctacctgtgagacggaagtggaggaggacagcagg
aagccagtgccgaggagagcgttccagcatcagcctgggaagaaaagacagacagaggag
gaggaaggagaagacaatcattgctttaagagtactgacccttgtagaaacaatgtggat
gatggtgcaaataacttgaaagaagccagtagagacaatcccgaacctctgaagtgcaaa
cagtggccaaaaggaacaaagcgtgctctgtctaagtggaggccaaacaaagagaggaag
actgggtttaaactgaacttgtacaccccgccagaaacacccttggagcctgatgaccag
gtaacagcagaagaacagaaggagactccagcagacaaaaccagccccacttccaccagg
attgaggagggggtcaaggaagccgtggaacccctgctgcctcaggacgaaaacggaagg
gaggagacgtgtgcacctataagtccaaataaatcaccgggtggaaaacctgaagacgag
ttaatcaaacctgaggaggaagaggaggaggaggaagaagaggaagaggaaagaaatgta
gaaaaagacgaccccagtggtgccaagagtcaggataaagaggagccagaagtctgcatg
gacaaagaagaccctgtgcatttggatgatcacgaagaggaggaggaagaggaggaagag
ccatctcacaacgaggggcatgatgccgatgatgaggatgacagtcacatggcgtctgct
gaagtgaaggaagaacacccaagagaagccttcaaagaagtactggaaaaccagggggct
tttttagaccttagtgccccgcctagtcattcaaacccagaggtcctaatggactgtggt
gttgacctcccagcttcatgtaatagtgaacctaaggagcttgctggagccactgaaact
gcccctgaatctgatgaggaacccccaggagagcaggcacagaagcaggaccaaaagaac
agtgaagaagcagattctgagttcaaagagggaaacacagccaccttggaaatagactct
gagaccgtccaagcggttcagtccttgacccaggagaacagtgaacaggatgacaccttt
caggattgtgccgagactcaagaggcctgtagaagcctacagaactacacccatgcagac
caaagcccgcagatctccgccgctctagatgactgccagcagtcagaccacagcagccca
gtttcatccgtccattcccaccctggccagtcagtacgttctgtcaacagcccaagcgtc
cctgccctggaaaacagctatgcccaaatcagcccggatcaaagtgccatctcagtgccg
tctctgcagaacatggaaaccagtccaatgatggatgtcccgtccgtttcggatcattcg
cagcaagttgtggacagcgggttcagtgacctgggcagtatcgagagcacaaccgagaac
tacgaaaaccccagcagctatgattctactatgggcggcagcatttgtggaaatggctct
tcacagaacagctgctcctacagcaacctcacctccagcagtctgacccagagcagctgt
gctgtgacccagcagatgtccaacatcagcgggagctgcagcatgctgcagcagaccagc
atcagctcccccccgacctgcagcgtcaagtctcctcaaggctgtgtggtggagaggccg
ccaagcagcagccagcagctggcgcagtgcagcatggctgcgaacttcacgccgcccatg
cagctggccgagatccccgagactggcagtgccaaccttggcttatatgaacggatgggt
cagagtgattttggggctgggcattacccacagccatcagccaccttcagccttgccaaa
ctacagcagttaactaatacacttattgatcattcattgccttacagccattccgctgct
gtaacttcctatgcaaacagtgcctctttgtccacaccattaagtaacacagggcttgtt
cagctttctcagtctccacactccgtccctgggggaccccaagcacaagctaccatgacc
ccaccccccaacctgactcctcctccaatgaatctgccaccacctctgttgcaacggaac
atggctgcgtcaaatattggcatctcccacagccaaagactgcaaacccagattgccagc
aagggccacgtctccatgagaaccaaatcggcatctctgtcaccagccgctgccacccat
cagtcgcaaatctatgggcgctcccagactgtagccatgcagggtcctgcacggacttta
acgatgcagaggggcatgaatatgagtgtgaacctgatgccatccccagcctacaatgtc
aactctgtgaacatgaacatgaacactctcaatgccatgaacgggtacagcatgtcccag
ccgatgatgaatagtggctaccacagcaaccatggctacatgaatcagacgccccagtac
cctatgcagatgcaaatgggcatgatggggacccagccatacgcccagcagccaatgcag
accccaccccacggtaacatgatgtacacggcccccggccaccacggctacatgaacaca
ggcatgtccaaacagtctctcaatgggtcctacatgagacggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system