KEGG   Capra hircus (goat): 102191821Help
Entry
102191821         CDS       T02910                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
chx  Capra hircus (goat)
Brite
Enzymes [BR:chx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102191821 (UCHL5)
Peptidases [BR:chx01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102191821 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 329 aa AA seqDB search
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTAAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEEPMDTDQGSNMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELL
KTLAEHQQLIPLVEKAKEKQNAKKAQETK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgccggggagtggtgcctcatggagagcgaccccggggtcttcaccgaa
ctcattaaaggatttggttgccgaggcgcccaagtagaagaaatatggagtttagagcct
gagaattttgaaaaattaaagccagttcatgggttgatttttcttttcaagtggcaacca
ggagaagaaccagcaggctctgtggttcaggactccagactggacacaatcttttttgcc
aagcaggtaattaataatgcttgtgctactcaagccatagtaagtgtgttattgaactgt
actcatcaagatgtccatttaggagagacattatcagagtttaaagaattttcacaaagt
tttgatgcagctatgaaaggtttggcgctgagtaattcagatgtcatccgacaagtgcac
aacagttttgccagacagcaaatgtttgagtttgacgctaagacagcagcaaaagaagaa
gatgcttttcactttgtcagttatgttcctgttaatgggaggctgtatgaactagatggg
ttaagagaaggaccgattgacttaggtgcatgcaatcaagatgactggatcagtgcagtg
aggccagtcatagaaaaaaggatacaaaagtacagtgaaggtgaaattcgatttaactta
atggctattgtgtctgacagaaaaatgatatatgaacagaagatagcagagttacaaaga
caacttgctgaggaggaacccatggatacagatcagggcagtaatatgttaagtgctatt
cagtcagaggttgccaaaaatcagatgcttattgaagaggaagtacagaaattaaaaaga
tacaagattgaaaatatcagaaggaagcacaattatctgccattcattatggaattgtta
aagactttagcagaacaccagcagttaataccactagtagaaaaggcaaaagaaaagcag
aatgcaaagaaagcacaggaaaccaaatga

DBGET integrated database retrieval system