KEGG   Capra hircus (goat): 102191825Help
Entry
102191825         CDS       T02910                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
chx  Capra hircus (goat)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102191825
  Amino acid metabolism
   00350 Tyrosine metabolism
    102191825
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102191825
Enzymes [BR:chx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102191825
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102191825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 145 aa AA seqDB search
ARLLLPGARLLTIELNPDYAAITQRMVEFAGLQDKVTVILGASQDVIPQLKEKYDVDTLD
MVFIDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIFPGAPDFLEYVRGSSRFECSHFSS
YLEYSKVVDGLEKAVYRGPSGPARP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
gcccgcctgctgctgccgggcgcccggctgctcaccatcgagctcaaccccgactatgcc
gccatcacccagcggatggtggagtttgcaggcctgcaggacaaggtgactgtcatcctt
ggagcatcccaggacgtcatcccccagctgaaggagaagtatgacgtggacacactggac
atggtcttcatcgaccactggaaagaccgctacctgccggacacgcttctgctggaggag
tgcggcctgctgcggaaggggaccgtgctgttggccgacaacgtcatcttccctggggcg
cccgacttcctggagtacgtgcgcgggagcagccgcttcgagtgctcgcacttcagctca
tacctggagtactccaaggtggtggacggcttggagaaggccgtctacaggggcccgagc
ggccccgcccggccctga

DBGET integrated database retrieval system