KEGG   Carboxydothermus hydrogenoformans: CHY_0104Help
Entry
CHY_0104          CDS       T00287                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:chy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(90538..92376)
Genome map
AA seq 612 aa AA seqDB search
MCGIAGMISFSKDLSPFVPLLEKMTQSLTHRGPDALGIWHSENIILGHRRLAVIDPERGR
QPMIRTFGDWQYVIVYNGELYNTKELRDELEARGHHFYTTCDTEVLLVSYIEWGKECLSK
LNGIFAFAIFDEKENQLFLARDRLGVKPLFYALVNDTLIFASEIKTLLLHPDIPSRLSTD
GLKEVLFLGPARTPGMGVFAHISELLPGDYAVFNPEGLFIKPYWRLTSNPHPDDFPTTVK
KTRELLEDAVIRQLVSDVPICTLLSGGLDSTVITAFAASHLHSRGETLNTFSVDYAENEL
YFTESAFQPNCDAMFIPLVAKEFNTLHRNIVLTQEELFEALFPALIARDLPGMVDIDSSL
WLFSREIKKEATVGLSGECADEIFGGYPWFFRKEALEAKTFPWALSLDRRKTLFRQDLIA
ELKPDEYVQKRYHEALEEIPEISGLSPEEKRLREITYLTLTRWMPILLDRKDRMTMAWGL
EVRVPYCDHRLVEYLWNVPWHFKTAGGQEKGLLRQAVADLIPDYILKRKKSPYPKTHHPL
YTKLVREALTQILAENSSPINFLIDENEVRKLITNPSPPNARPWFGQLMGDTQIMAYLIQ
LNYWFKKYHISF
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgcaggtatgataagtttttctaaggatttatcaccttttgttcctcta
ttagaaaaaatgacccaatcccttacccaccgcggtccagacgctttaggtatttggcat
tcggaaaatatcattcttggacaccggcgactggcggtcatcgatccggagcgggggcgg
caaccgatgattcgcaccttcggggattggcagtacgttatcgtttacaacggtgagctc
tataataccaaagagcttcgggatgagttagaagctcggggacaccatttttacaccacc
tgtgataccgaagttttactggtttcctacattgaatggggcaaagaatgtctttctaaa
ttaaacggtatctttgcctttgccattttcgatgaaaaagaaaaccagctttttttagcc
cgggaccggctcggagtaaagccccttttttatgctctggtaaatgataccttgattttt
gcttctgaaattaaaacccttcttcttcatccggacatcccttccaggctttccaccgat
ggcttaaaagaagtattgtttttgggtcccgcccgcaccccgggaatgggagtttttgcg
catatttccgaactacttcccggcgattatgccgtatttaacccggaaggtttatttata
aaaccctactggcgacttacttctaatccccatcccgatgatttccccactacggtgaaa
aaaacccgggaacttttagaagacgcggttattcgccagttggtttccgatgtacccatt
tgcacccttttatccgggggtcttgactcgacggtaattactgcttttgccgccagccac
cttcatagccggggcgaaactctaaacaccttttcggtggattatgcggaaaacgaactg
tattttaccgaaagcgcctttcagcccaattgcgatgctatgtttatccctttggttgcc
aaagagtttaacacccttcatcgtaatatcgtgttaactcaagaagaactttttgaagcg
ctatttccggctttaatcgctcgcgaccttcccggtatggtcgatattgattcatccctg
tggctttttagccgggaaataaaaaaagaagccaccgtgggcttatcgggagaatgtgcc
gacgaaattttcggcggctatccctggttttttagaaaagaagcccttgaagccaagact
ttcccctgggctctaagcttggaccgccgaaaaaccctttttagacaagatttaattgcc
gaattaaagcccgatgaatatgtccagaaacgctatcacgaagctttagaagaaattcct
gaaatttcgggattatccccggaagaaaaaaggcttcgggaaataacttaccttaccctc
acccgctggatgcctatattactggaccgcaaagaccggatgaccatggcctggggtctg
gaagtacgggtgccgtattgcgaccaccggctggtggaatatttgtggaatgttccctgg
cactttaaaaccgctggaggccaggaaaaaggtttactacggcaggcagtagcggatctt
attccggactacatcctcaagcgtaaaaaatctccttatcccaaaactcatcatccgctt
tataccaaactggtaagagaagcactaacgcaaatcttggccgaaaactcttccccgatt
aacttcctgatagatgaaaacgaggtccgaaaactaatcaccaatccctctcccccaaac
gcccgcccctggtttggccagttaatgggcgatacccagattatggcgtatttaattcaa
ctaaattactggtttaaaaaataccatatttctttttaa

DBGET integrated database retrieval system