KEGG   Carboxydothermus hydrogenoformans: CHY_0270Help
Entry
CHY_0270          CDS       T00287                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHY_0270 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHY_0270 (glcK)
   00052 Galactose metabolism
    CHY_0270 (glcK)
   00500 Starch and sucrose metabolism
    CHY_0270 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CHY_0270 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CHY_0270 (glcK)
   00524 Butirosin and neomycin biosynthesis
    CHY_0270 (glcK)
Enzymes [BR:chy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CHY_0270 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
236621..237577
Genome map
AA seq 318 aa AA seqDB search
MGNYVVGIDLGGTKIYTALANLNGEIVAEEIEPTTKDETKLLHQLGNMVKGVIAKSAVPK
EKVLGIGIGAPGTVDHRTGTLITAPNLPWQNYPLKINLQALLRLPVEVDNDANLAALGEY
RYGAGRGHKDMVYVTVSTGIGAGIIIDGQLYRGSSGSAGELGHTIVEPGGPRCNCGRRGC
LEVMASGTAIGERARQLVAEGFGQEILKLAQGNIEAINAKTVGEAFLAGDPEAKGILNEV
AFYLGIGLANVVNLLNPSLIVLGGGVINIGEPFLELIREELAEKALPQPYKDLTVKKAVL
GSKTGVMGAIALALERFS
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattatgttgtggggatagacctgggaggtacgaaaatttatactgccctggct
aacttaaatggtgaaatagtggcggaagaaattgagccgactaccaaagacgaaacaaaa
cttttacaccagcttgggaatatggttaaaggagttattgccaaaagcgcagtaccgaag
gaaaaagtgctgggaatcgggattggtgcgccgggaacggtggaccaccgtaccggaacg
cttattaccgctcccaatcttccctggcaaaattacccgcttaaaataaatttgcaagcg
ttgctccgtttaccggtggaagttgataacgatgccaatttagcagctttgggtgagtac
aggtacggtgctggccggggccataaagacatggtttatgtcaccgtaagtaccgggatt
ggtgcgggtataataatagatggacagctctatcggggaagctccggcagtgccggtgag
ttaggccataccattgttgaaccggggggtccccggtgcaattgtggccgacggggctgt
ctggaagtaatggcctcgggtacggcaataggagaaagggcacggcaattggtggccgaa
ggttttggccaggaaattttaaaattggctcaggggaatattgaggctattaacgctaaa
acggtgggggaagcgtttttagcgggcgacccggaagcaaaaggaatattaaacgaagtg
gctttttatctggggataggtctggccaatgtggtgaacctcttaaacccatctctaatc
gtcctgggaggcggggttataaatattggcgaaccctttttagagttaattcgagaagag
ctggcagagaaggctttaccccagccctataaagatttaacggtaaaaaaagctgtttta
gggagtaaaaccggagtcatgggagcgatagctttagccttggagcggttttcttaa

DBGET integrated database retrieval system