KEGG   Carboxydothermus hydrogenoformans: CHY_0572Help
Entry
CHY_0572          CDS       T00287                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHY_0572
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHY_0572
   00620 Pyruvate metabolism
    CHY_0572
   00640 Propanoate metabolism
    CHY_0572
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CHY_0572
   00680 Methane metabolism
    CHY_0572
Enzymes [BR:chy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CHY_0572
Lipid biosynthesis proteins [BR:chy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CHY_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
491557..493185
Genome map
AA seq 542 aa AA seqDB search
MVDYEKTYREFRHQVPEYFNFARDTFDVWAQDPNKLAMLWVDDFGNERRFTFKQFSELSK
QTANFFNFLGVKQGDRILVILPRLPEWWVIYLAAIRAGIIFIPGTTQLTSKDIKYRVETA
ETVMVITDEDNAAKVEEIKGELPVLKHLVIVGKRDGWLSLNEEIAKFSPEYEAANTKSDD
PAIIFFTSGTTGYPKMAVHTHASYPIGHYITGKYWLDLTPDDLHWNMSDTGWAKAAWSSF
FGPWICGAAIFVHHSVGKFDAKKTLELLAKYPITTFCGPPTAYRVFVLEDLKKYKFPHLR
HCVAAGEPLNPEVIKVWKEATGLTIRDGYGQTETCVLVANFPCFEVKPGSMGKPAPGYYV
SIIDDEGNELPPGKEGNIAIKVKPERPVGLFKEYWKNPDKTAEVFRGDWYLTGDRAIKDE
DGYFWFVGRADDVILAAGYRIGPFEVESALVEHPAVAEAAVVASPDEIRGEIVKAFVVLA
PGYSPSEELVKELQEHVKKVTAPYKYPREIEFIDALPKTVSGKIRRVELREREWAKKLGK
KK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggtcgactatgaaaaaacttaccgtgaatttcggcaccaggtgcccgagtattttaat
tttgcccgggatacttttgatgtctgggcccaagatccgaataaacttgctatgctctgg
gtcgatgacttcggcaatgaacggcgttttacttttaaacaattttcagaattatcaaaa
caaactgccaatttctttaattttctgggggttaagcagggggaccgaattttagttatt
ttgccgcggttaccggaatggtgggtaatttacctggcggcaattcgggctgggataatt
tttattccggggactacccagctgacttctaaggatattaaataccgggtggaaacagcg
gaaacggttatggtgattaccgatgaggataatgcggccaaggtggaagaaattaaagga
gagttaccggtattaaaacatctcgtaatcgtcggcaagagggacggatggctttcctta
aacgaggagattgctaaatttagtccggagtacgaagctgctaacactaaaagcgatgac
ccggcgattatctttttcacttcgggaaccaccggctatcccaagatggccgtgcatacc
cacgccagttacccgataggccactatattaccggaaagtactggctggatttaactccc
gatgacctgcactggaatatgtccgataccgggtgggcaaaagcggcctggtccagcttt
tttgggccgtggatttgcggtgcggcaatttttgtccaccattcggtgggtaaatttgac
gctaaaaaaacgttggagcttttagctaaatatcccatcaccaccttctgtggtccgcca
accgcttaccgggtttttgttctggaagatttaaaaaagtataagtttccgcatttacgc
cattgcgtagctgcgggcgaacctttaaaccccgaggtaatcaaagtgtggaaagaagca
accgggctaaccatccgggatggttacggccaaacggaaacctgcgtcctggtggcgaac
ttcccctgttttgaagtaaaacccgggtcgatgggtaaaccggctcccggctattatgtc
tcgatcattgacgatgaagggaacgaactgccgcccggcaaggaaggtaatattgccatt
aaagttaaaccggagcggccggtgggactgtttaaagaatactggaaaaatcccgataaa
accgccgaagtgttccggggcgactggtatttaaccggcgaccgggctattaaagatgag
gatggctacttctggtttgtgggccgggctgatgatgttatcctggctgccggctaccgg
ataggaccgtttgaggtggaaagcgccctggtggagcatccggcggtggccgaggcggcg
gtcgtggcgagccccgatgaaatccggggagaaattgtcaaggcgtttgtggtactggcc
ccgggatattctccgtcggaggaactggttaaagaattgcaggagcacgtgaagaaagtt
accgctccttataagtacccgcgggaaatcgaatttatcgatgctttacccaaaaccgtt
tccggtaaaatccgccgggtggagttgagggaaagagagtgggccaaaaagctcggtaaa
aagaaataa

DBGET integrated database retrieval system