KEGG   Carboxydothermus hydrogenoformans: CHY_0572Help
Entry
CHY_0572          CDS       T00287                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:chy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:chy00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:chy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:chy00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:chy00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:chy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
491557..493185
Genome map
AA seq 542 aa AA seqDB search
MVDYEKTYREFRHQVPEYFNFARDTFDVWAQDPNKLAMLWVDDFGNERRFTFKQFSELSK
QTANFFNFLGVKQGDRILVILPRLPEWWVIYLAAIRAGIIFIPGTTQLTSKDIKYRVETA
ETVMVITDEDNAAKVEEIKGELPVLKHLVIVGKRDGWLSLNEEIAKFSPEYEAANTKSDD
PAIIFFTSGTTGYPKMAVHTHASYPIGHYITGKYWLDLTPDDLHWNMSDTGWAKAAWSSF
FGPWICGAAIFVHHSVGKFDAKKTLELLAKYPITTFCGPPTAYRVFVLEDLKKYKFPHLR
HCVAAGEPLNPEVIKVWKEATGLTIRDGYGQTETCVLVANFPCFEVKPGSMGKPAPGYYV
SIIDDEGNELPPGKEGNIAIKVKPERPVGLFKEYWKNPDKTAEVFRGDWYLTGDRAIKDE
DGYFWFVGRADDVILAAGYRIGPFEVESALVEHPAVAEAAVVASPDEIRGEIVKAFVVLA
PGYSPSEELVKELQEHVKKVTAPYKYPREIEFIDALPKTVSGKIRRVELREREWAKKLGK
KK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggtcgactatgaaaaaacttaccgtgaatttcggcaccaggtgcccgagtattttaat
tttgcccgggatacttttgatgtctgggcccaagatccgaataaacttgctatgctctgg
gtcgatgacttcggcaatgaacggcgttttacttttaaacaattttcagaattatcaaaa
caaactgccaatttctttaattttctgggggttaagcagggggaccgaattttagttatt
ttgccgcggttaccggaatggtgggtaatttacctggcggcaattcgggctgggataatt
tttattccggggactacccagctgacttctaaggatattaaataccgggtggaaacagcg
gaaacggttatggtgattaccgatgaggataatgcggccaaggtggaagaaattaaagga
gagttaccggtattaaaacatctcgtaatcgtcggcaagagggacggatggctttcctta
aacgaggagattgctaaatttagtccggagtacgaagctgctaacactaaaagcgatgac
ccggcgattatctttttcacttcgggaaccaccggctatcccaagatggccgtgcatacc
cacgccagttacccgataggccactatattaccggaaagtactggctggatttaactccc
gatgacctgcactggaatatgtccgataccgggtgggcaaaagcggcctggtccagcttt
tttgggccgtggatttgcggtgcggcaatttttgtccaccattcggtgggtaaatttgac
gctaaaaaaacgttggagcttttagctaaatatcccatcaccaccttctgtggtccgcca
accgcttaccgggtttttgttctggaagatttaaaaaagtataagtttccgcatttacgc
cattgcgtagctgcgggcgaacctttaaaccccgaggtaatcaaagtgtggaaagaagca
accgggctaaccatccgggatggttacggccaaacggaaacctgcgtcctggtggcgaac
ttcccctgttttgaagtaaaacccgggtcgatgggtaaaccggctcccggctattatgtc
tcgatcattgacgatgaagggaacgaactgccgcccggcaaggaaggtaatattgccatt
aaagttaaaccggagcggccggtgggactgtttaaagaatactggaaaaatcccgataaa
accgccgaagtgttccggggcgactggtatttaaccggcgaccgggctattaaagatgag
gatggctacttctggtttgtgggccgggctgatgatgttatcctggctgccggctaccgg
ataggaccgtttgaggtggaaagcgccctggtggagcatccggcggtggccgaggcggcg
gtcgtggcgagccccgatgaaatccggggagaaattgtcaaggcgtttgtggtactggcc
ccgggatattctccgtcggaggaactggttaaagaattgcaggagcacgtgaagaaagtt
accgctccttataagtacccgcgggaaatcgaatttatcgatgctttacccaaaaccgtt
tccggtaaaatccgccgggtggagttgagggaaagagagtgggccaaaaagctcggtaaa
aagaaataa

DBGET integrated database retrieval system