KEGG   Carboxydothermus hydrogenoformans: CHY_0585Help
Entry
CHY_0585          CDS       T00287                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CHY_0585 (tdk)
Enzymes [BR:chy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CHY_0585 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
504169..504720
Genome map
AA seq 183 aa AA seqDB search
MGRIEVITGPMFSGKSEELVRRALRLMYAKKKVIAFHHALDNRFGHKKIVSRSGFELESY
PVQNFAFEVIWDLAKDYDAVLVDEAQFFSDELVDTCLNLRRRSKIVVVSGLDLDVYENPF
GPMPKLLALADRVDKLKAVCFECGEEATISYRLSGEKEQIVVGDKNYIALCYRCYYAKKK
EER
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggggagaattgaggtcattaccggtccaatgttctccgggaaatcggaggaactggtg
cgcagagccttgcggcttatgtatgctaagaaaaaagtaatagcatttcaccatgctctg
gataatcgcttcgggcataaaaaaatagtcagtaggagcgggtttgaactggaatcctac
ccggttcaaaattttgcttttgaggtaatctgggatttagcaaaagattatgatgcggtt
ttagttgatgaagctcaattttttagtgacgaactggtggatacctgtttaaatttgcgc
cggcgttcgaaaattgtggtggtttccggtttggatttggatgtttacgaaaatcctttt
ggcccaatgccgaaactgttagctctggctgacagggtggataaattaaaagccgtttgt
tttgaatgcggagaggaagctacgatatcatatcgtttatcgggggagaaggaacaaata
gtggttggagacaaaaattacatcgccctgtgttaccgctgttattatgccaagaaaaaa
gaagagcggtag

DBGET integrated database retrieval system