KEGG   Carboxydothermus hydrogenoformans: CHY_0659Help
Entry
CHY_0659          CDS       T00287                                 

Gene name
acoE
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHY_0659 (acoE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHY_0659 (acoE)
   00620 Pyruvate metabolism
    CHY_0659 (acoE)
   00640 Propanoate metabolism
    CHY_0659 (acoE)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CHY_0659 (acoE)
   00680 Methane metabolism
    CHY_0659 (acoE)
Enzymes [BR:chy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CHY_0659 (acoE)
Lipid biosynthesis proteins [BR:chy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CHY_0659 (acoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571935..573878
Genome map
AA seq 647 aa AA seqDB search
MSDNFEALLQESRIFEPPAEFKEKAKVADLSLYEWAERDFLGFWADAAKDIEWFLPFEKV
LDDSDAPFYRWYTGGKLNVSYNCVDRHTKSFRRNKAALIFEGEPGDSKILTYQELYREVN
KFANVLKKLGVQKGDRVTIYMPMIPEAVIAMLACTRIGAPHSVVFGGFSSQALKDRIDDA
KAKLLITADGGYRRGSIVELKKNADAALEGETTIEKVVVVKRTGQEVPMTEGRDYWYHEL
MADAALYCEPEQCDAEDMLFILYSSGTTGKPKGIQHTTGGYLVGVHTTFKYIFDYREEDI
YWCTADIGWITGHSYIVYGPLSNGATVVLYEGAPDWPQKDRFWEIIEKYRVNILYTAPTA
IRTFMRWGEKWPKGRDLSSLRLLGTVGEPINPEAWIWYHEHIGGGRCPIVDTWWQTETGM
IMITPLPGVIPTKPGSATKPFPGVEADVVNDKGEPVPPGQGGYLVLKKPWPAMLRTLYGD
PERYKNTYWSKFPGWYFTGDGAKKDEDGYFWILGRVDDVINVSGHRIGTMEVESALVEHP
LVAEAAVIGKSHEVKGQAIAAFVTLKEGVEGTPELVQELKQFVAQKIGALARPDDIFFTA
ELPKTRSGKIMRRLLRDIAEGRALGDTTTLTDPAVINKIKEQYKDEG
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataattttgaagcgctcttgcaggaaagccgtatttttgaaccgccggcagaa
tttaaagaaaaagccaaagttgcggacttatccctttatgaatgggccgagcgggatttt
ttaggtttctgggcggatgcggccaaagatatcgagtggtttttgccctttgagaaagta
ttggatgattccgatgcaccattttaccgatggtataccggtggaaagttaaacgtttcc
tacaattgcgtggaccggcacaccaaaagctttcgccgcaacaaagcagcgttaatcttt
gaaggcgaaccgggggattcaaaaattttaacctatcaggagttgtaccgggaagtaaat
aaatttgccaatgttttgaaaaagttgggggtgcaaaagggagacagggttaccatttac
atgccgatgattcccgaagcggtaattgcgatgttagcctgcacccgcattggtgcaccc
cacagcgttgtgtttggtggttttagttcgcaggcgttgaaagaccggattgatgatgcc
aaggccaagcttttaataactgccgacggtggttaccgccggggaagtattgttgaatta
aagaaaaatgccgatgctgccttagaaggggaaaccaccattgaaaaggtggtggtggtg
aaaagaacggggcaggaagtgcccatgaccgagggcagggactactggtaccacgagtta
atggccgatgcggctctatactgcgagccggagcagtgcgatgcggaagatatgcttttt
atcctttactcttccgggactaccggtaaacccaaaggcattcagcataccaccggcggt
tatctggtaggggtccataccacctttaaatacatttttgattaccgggaagaagatatt
tactggtgcaccgccgatataggctggattaccgggcacagctacattgtttacgggcca
ctgtccaacggtgctaccgttgttttatatgaaggtgctcccgactggccgcaaaaagac
cggttctgggagattattgaaaaataccgggtaaatatcctttatactgctccgacggcc
attcgaacctttatgcgctggggagaaaagtggccgaaaggacgggatctgtccagttta
cggcttctggggacggtgggtgaaccgattaacccagaggcctggatttggtatcacgaa
catattggcggcggccgctgtccgatagtcgatacctggtggcagacggaaacgggaatg
attatgattactcctttacccggcgtgattcccaccaaacccggttcggctaccaagcct
ttccccggggtggaagcggacgtggtcaatgataaaggtgaaccggtacctcccggacag
ggtggttatttggtgctgaaaaaaccgtggccggcaatgcttcgcactttgtatggcgat
ccggaacggtataaaaacacctactggagcaagttcccgggctggtattttaccggtgat
ggggcgaaaaaagatgaagatggctacttctggattttaggacgggtagacgatgtcatt
aacgtttccggccaccggataggtaccatggaagtggaaagtgctttagtggagcatcct
ttggtggcggaagcagcggtaatcggcaagagccatgaagtaaaaggccaggcgatagct
gctttcgtcaccctgaaagaaggggtagagggtacccccgaattggtgcaggagttaaaa
cagtttgttgcccagaaaattggtgctcttgcccggccggatgacatcttctttactgct
gagcttcccaagacccgcagtggtaagattatgagaagattactccgggacattgccgag
ggtcgggcactaggtgacactactactttgaccgatccggcggttataaacaaaataaaa
gaacagtacaaagacgaaggttaa

DBGET integrated database retrieval system