KEGG   Carboxydothermus hydrogenoformans: CHY_0751Help
Entry
CHY_0751          CDS       T00287                                 

Definition
(GenBank) putative tryptophan synthase, beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CHY_0751
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CHY_0751
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CHY_0751
Enzymes [BR:chy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CHY_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(662093..663370)
Genome map
AA seq 425 aa AA seqDB search
MSKVNLPKYYYNLKADLPELPPPPLHPFTGQPISPADLESLFPKSLIEQEISTERFIEIP
EKVREAYAEYRPTPLKRAKKLEKYLNTPARIYFKYEGTNASGSHKLNTALAQAYFNKLDG
TEQLTTETGAGQWGSALAYAANFFGLKLTVYMVGISYDQKPYRRIFMETFGARVVKSPSP
ETAAGRKVLEADPNSPGSLGIAISEAVEVAMSDPKTKYALGSVLDHVLLHQTVIGQEVYE
ELSLLGEKPDVLIACVGGGSNFGGFTFPFVREKLKGENIEIIAVEPKACPTLTEGEYKYD
FGDVAGLTPKMPMYTLGYDFIPPGIHAGGLRYHGDSPLVSLLYKNKIISAKAYPQLKVFE
AGVTFARTEGIIPAPESSHAIAAAIDEAIKCREESVAKTIVFNLSGHGYFDLSAYEAYFA
GKLKD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtaaatttacccaagtattactacaaccttaaggcagaccttcccgaactt
ccacccccgcctcttcatccctttaccggtcagcccatctcgccagcggatttagagagt
ctttttcctaaaagtttaattgaacaggagatttctaccgaacgtttcattgaaattccc
gaaaaagtccgggaagcttacgccgagtaccgtccaaccccacttaaaagggctaaaaag
ttagaaaagtatctaaatactcccgccagaatttactttaagtacgaaggtaccaacgct
tccggcagtcacaagcttaataccgctctggcccaggcttatttcaacaagctggatgga
accgaacagcttaccaccgaaaccggagccggtcagtgggggagcgctttagcttatgcc
gccaattttttcgggctgaagttaaccgtatatatggtgggtataagctatgaccaaaag
ccgtaccggaggattttcatggaaactttcggcgcccgggtggtaaaaagcccaagtccg
gaaactgctgccggacgtaaggttttagaagcagaccctaattctccgggaagccttggg
atagctatcagcgaagcggtagaagtagcaatgagtgaccccaagaccaagtacgctttg
ggaagtgttttggaccacgtccttttacaccagacggttatagggcaagaggtttatgag
gaattatcccttttgggagaaaagcccgatgtcttgattgcctgcgtgggcggtggcagt
aacttcggtggctttacctttccttttgtgcgggaaaaattaaaaggtgaaaatattgaa
ataattgctgtagagccaaaggcctgcccaacccttaccgaaggggaatataaatacgac
tttggcgatgttgccggccttactcctaaaatgccgatgtatactttaggctacgatttt
atcccgccgggcatccatgcgggaggacttcggtaccacggcgattcacctttggtaagc
cttctttataaaaataaaattatttccgctaaagcttatccccagttaaaggtatttgaa
gctggagtaacctttgcccgtaccgaaggcattatcccggcaccggaatcttcccacgct
atcgccgcagctattgatgaagcaattaaatgccgggaagaaagtgttgccaaaactatt
gtctttaatttaagcgggcacggctattttgacttgtccgcgtatgaagcatattttgct
ggcaaacttaaagattga

DBGET integrated database retrieval system