KEGG   Carboxydothermus hydrogenoformans: CHY_0789Help
Entry
CHY_0789          CDS       T00287                                 

Gene name
aor1
Definition
tungsten-containing aldehyde ferredoxin oxidoreductase (EC:1.2.7.-)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CHY_0789 (aor1)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CHY_0789 (aor1)
Enzymes [BR:chy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CHY_0789 (aor1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
697724..699517
Genome map
AA seq 597 aa AA seqDB search
MAGYCGKVLRVNLSTGEIKKEPLDLEVAKKFLGGRGLGSYILSKEIDPAVDPLSPENKII
FATGPLTGSSAPTSGRYMVVTKSPLTGTIASSNSGGFWGAELKFAGYDLIIVEGKAAKPS
YIYINDDTVEIRDAQNYWGKLVSETTELLQKEVGDPKARVLTIGPAGERLSPIAAVMNEK
YRAAGRSGVGAVMGSKNLKAIVVRGSGKIEPAEPEKTKELLSRLLKKIREDGVTGQGLPN
YGTAVLVNIINENGILPTNNFQKSYFPTADAISGETLSEKYLVKKDPCYRCPIACGRYCK
VDDEEGGGPEYETIWAFGADCGVDDLAAIIKANNLCNEYGLDTISAGATIACAMELYEKG
HIKKEELDGPELKFGSAEAVIEWTRKMGAGEGFGAKLALGSYRLAESYGVPELSMSVKKQ
ELPAYDPRGVQGHGLQYATSNRGGCHVRGYLISPEILGSPEKIDRFALEGKANWAKLFQD
LTAVIDSLGLCLFTSFALNADDYRELFNYIVGENYTTEDILTAGERIWNLERVFNLKAGI
DAKEDTLPKRLLEEPVPDGPSKGHKHRLAELLPEYYKVRGWDEKGVPTAEKLQALGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccggctattgcgggaaagtattgagggttaacctctccaccggtgaaattaaaaag
gaaccgctggatttggaggtggccaagaagtttttaggcggtcggggtttgggaagttat
attttatccaaagaaatcgaccctgctgtggatccgctatctccggaaaacaaaattatt
tttgctaccggtccattgaccggatcatcggcgccgacctccggacgctacatggtggta
actaaatctccgcttaccggtactattgccagttccaactccggaggcttttggggggct
gaattaaaatttgccggctatgatttaatcattgtagaaggaaaagcggcaaaaccaagc
tacatatatattaatgatgacaccgttgaaatccgggatgcgcagaattactgggggaaa
ttagtatctgaaaccaccgagcttttacaaaaagaagtgggagatcccaaagcccgggtc
ttgaccattggtcctgccggggaaaggctttcgcccatagctgccgttatgaacgaaaaa
taccgggctgcaggtcgttccggtgtaggagcggtaatgggcagcaaaaacttaaaagca
attgtggtaagagggtccggaaaaattgaaccggcggagccggaaaaaaccaaggagctc
ttatccagacttttaaagaaaattcgagaagatggggttaccggtcagggcttgcccaat
tatggtaccgcggttctggtaaatattatcaatgaaaacggtattttacccactaacaac
ttccaaaaatcttacttcccaactgccgatgctatttccggggaaactttatccgaaaaa
tatttagtgaaaaaagacccctgctaccgttgtccgattgcgtgcggtcgttactgcaaa
gttgatgatgaagaaggcggcgggccggagtacgaaactatctgggcctttggtgccgat
tgcggcgttgacgatttagctgccataattaaagccaataacctgtgcaacgaatacggc
ttagatacgatttccgcaggagcaaccattgcctgcgctatggagctttacgaaaaaggc
cacattaagaaagaagaattagacggtccggagttaaagtttggttctgccgaagctgtc
attgaatggaccaggaagatgggggcgggcgaaggttttggagccaaactggcccttggg
tcgtatcggttagccgaatcttacggtgttccggaactttcgatgtcggtgaagaaacag
gaattaccggcttatgacccccgtggtgttcagggccatggtctgcagtatgctacttcc
aaccggggaggctgtcacgtccggggttacctgatttctccggaaattctcggctctccg
gaaaaaattgaccgctttgctttagaaggaaaagccaactgggccaagctcttccaggac
ttaacggcggtcattgactcccttggtctttgcctcttcacctcctttgccttaaatgcc
gatgactaccgggaactctttaactatatcgttggggaaaattacactacggaagatatt
ttaactgccggcgaacgaatctggaatttagagcgggtctttaacttaaaagcgggaatc
gatgctaaagaggataccttacccaagcggcttttagaagaacctgtacccgatggaccg
tccaaaggacataaacaccgcctggcagaacttttaccggagtattacaaggtacggggt
tgggacgaaaaaggggtaccaaccgccgaaaagttgcaagctttaggtttataa

DBGET integrated database retrieval system